#DRIVE Mod

#DRIVE Mod APK 3.1.526 [Unlocked]

Trusted   Update on: 2026-03-06

  • #DRIVE screenshots
  • #DRIVE screenshots
  • #DRIVE screenshots
  • #DRIVE screenshots
  • #DRIVE screenshots
App name#DRIVE Mod APK 3.1.526 [Unlocked]
Version3.1.526
Update on2026-03-06
Size215.77 MB
Price Free
Rating 5.0
SystemAndroid 7.0 (N)
Mod info Unlocked
Developer
Category Racing
Get it on Google Play
Download original apk
Share
Download Links:

#DRIVE Mod APK 3.1.526 [Unlocked]

Use HappyMod App to get faster download!
You can still download from this domain (happymod.to) for now, but we strongly recommend switching to our new official domain for future updates and support: Download #DRIVE at HappyMod.net.
* All mod apks are uploaded by users. If there is any infringement, please contact us to remove it.

# Mod Info

The main advantages / modifications of #DRIVE Mod APK 3.1.526 [Unlocked]

Unlocked

# 1970s cars can be unlocked.

The 1970s are brought back to life through the game #DRIVE. New vehicles can also be found in this latest version of the game— The Thunder and The Fishbowl. Additionally, different scenes can be found in every game— making the games themselves impossible to ignore. You need to upgrade cars you desire as you travel the world in search of resources. Doing so boosts their performance and makes it easier to collect more.

# Racing on a spectacular environment with high stakes.

Challenge the player while driving the car in #DRIVE, a racing game that includes both a stunning and comprehensible gameplay style. Players must travel to various locations while overcoming challenges on the track. To drive the vehicle, simply swipe the left or right edge of the display. Press both sides simultaneously to activate the car's emergency brakes. When playing the game from a third-person perspective, you can see your car from further away than usual. This makes it easier to view the surrounding environment because the gameplay involved relates to those elements. When exploring new environments, you also avoid collision with nearby obstacles by keeping your distance. Nothing compares to the thrill of traveling through a variety of unique terrains.

# Coming face to face with challenges during the game

You must learn how to drive in order to master the art of #DRIVE. As you travel down the road, you may encounter other vehicles. However, you may also face difficulties dealing with police cars that chase you at every turn. You need to pay attention to the health bar, fuel bar and score bar when playing this game. This is because they're vital parts of the experience that mustn't be ignored. Furthermore, this game doesn't require you to be in the first place; you can choose to be anywhere on the screen. Pay close attention to the game's environment when moving through it. You'll notice many different things when you look around. The first thing you'll notice are gas stations that you can see from the environment. These locations will have significant elements that reveal their location. To stay functional, you need to regularly fuel your car. You must arrange this aspect correctly since gasoline usually appears on one side or the other. Another thing you can’t ignore is the cars on the road. Cars travel on the road and occasionally cause your current level to halt if they need to avoid a collision. Colliding with cars also causes damage to the vehicle and sometimes disrupts your gameplay if the police car that trails it in some cases is involved. Just as this vehicle continually smacks into your rear end, it never outraces you to impede your progress. As a result, that's the pursuit you need to pursue to discover a solution.

# Information about the film #DRIVE can be found here.

Thanks to simple concepts, the game #DRIVE is the number one choice for car lovers. No levels, no enemies or bosses; just a need to hold a steering wheel and be continually driven across an endless landscape. Pixel Perfect Dude has released a few sports-themed games for both iOS and Android; among these is Extreme Beach Volley. Many people haven’t heard of the publisher despite releasing games like Voodoo. Unlike classic racing games, their games don't develop like Subway Surfer— they have endless running gameplay similar to that of #DRIVE.

# Gameplay

Driving through the game #DRIVE takes you through many different locations. From snow-covered roads to hot asphalt, your journey will be full of surprises. You will often encounter carefree sightseers who don't pay attention to their surroundings. The police usually only attempt to impede your progress when you are forcefully propelling yourself forward. If pursued, don't forget to visit a nearby donut shop. You need to keep track of the vehicle's fuel bar and damage at all times. You also need to monitor your distance by periodically checking the fuel bar and noting any damage to the vehicle. Having these two pieces of information allows you to determine when you need to stop and repair. Doing this will enable you to continue your journey with new points toward victory.

# Acquire bottle caps as a collection.

This game doesn’t require competitors to go fast. There are no obstacles that require you to slow down; your main opponent is your greed. The length of each distance is measured by the number of points awarded. This game isn’t easy or devoid of challenge. On your quest, you’ll face many complications. Additionally, the game features many diversions intended to distract players. Debris can cause your vehicle to break apart if you're distracted for even a second. Look out for sand issues on roads near the desert. Vehicles traveling on this road have a hard time staying on track due to the loose dirt. Moving at high speeds, it's easy to lose control and collide with houses on the side of the road. Money is awarded for collecting bottle caps on the journey. However, collecting too much money can be leading to your demise. This is because some people mistakenly follow a lucrative coin route only to find a vehicle moving slowly in front of them. Any professional will tell you that reaching your ultimate goal is your most important task.

# The game’s controls are easy to understand.

The pick and play mechanics of #DRIVE makes it easy to drive. Players can easily control the car by touching one side of the screen or holding both thumbs to brake. You can freely roam the world through the Endless Run game mechanics. From towns to beaches and snow-covered mountains, you can travel in your vehicle. #DRIVE's third percentile only accounts for 3% of the data.rspective, which allows you to see the vehicle from the rear. This is easy to understand.

# #DRIVE Mod APK 3.1.526 [Unlocked] Features:

#DRIVE is an endless driving videogame inspired by road and action movies from 1970s. As simple as possible, allowing the player to pick a car, pick the place and just hit the road. Just be aware not to hit anything else!

No matter where we drive, no matter what we drive or how fast we drive. We simply chose to drive. And you?

1970s cars can be unlocked.
Racing on a spectacular environment with high stakes.
Coming face to face with challenges during the game
Information about the film #DRIVE can be found here.
Gameplay
Acquire bottle caps as a collection.
The game’s controls are easy to understand.

# #DRIVE Brief Introduction

#DRIVE is an exhilarating and high-octane mobile game that puts players in the driver's seat of various vehicles, giving them the ultimate experience of a thrilling road trip. Developed by pixel perfectdude, this game offers a visually stunning and immersive open-world environment with endless roads stretching into the distance. With its simple and addictive gameplay, #DRIVE takes players on a journey filled with adrenaline-pumping action, captivating landscapes, and an ever-changing day-night cycle. Strap in, hit the accelerator, and get ready to embark on a road trip like no other in #DRIVE.

# How to download and install #DRIVE Mod APK 3.1.526 [Unlocked]?

// Option A //

To download #DRIVE mod from HappyMod.to.
You need enable the option "Unknown Sources".
1. Click on the above link to download #DRIVE mod APK.
2. Save the file in your device Downloads folder.
3. Now tap on Install and wait for the installation to finish.
4. Once it is done, open the game and start playing it right away.

// Option B //

To download #DRIVE from HappyMod APP, you can follow this:
1. Open your browser and download the HappyMod APK file from HappyMod.to - the only official website of HappyMod.
2. Open Android Settings and go into Privacy or Security.
3. Tap the option to Allow Unknown Sources and enable it.
4. Go to your Android downloads and tap the APK file.
5. Follow the directions on the screen to install it.
6. Search #DRIVE in HappyMod App.

# Full Specifications of #DRIVE Mod APK 3.1.526 [Unlocked]

// Download Information //

Size215.8MB
Version3.1.508
Version Code30608000
Langaf am ar as az be bg bn bs ca cs da de el en en-AU en-CA en-GB en-IN en-XC es es-US et eu fa fi fr fr-CA gl gu hi hr hu hy in is it iw ja ka kk km kn ko ky lo lt lv mk ml mn mr ms my nb ne nl or pa pl pt pt-BR pt-PT ro ru si sk sl sq sr sr-Latn sv sw ta te th tl tr uk ur uz vi zh zh-CN zh-HK zh-MO zh-TW zu

More...[+]

// Operation Systems //

PermissionINTERNET ACCESS_NETWORK_STATE AD_ID ACCESS_ADSERVICES_TOPICS ACCESS_ADSERVICES_ATTRIBUTION BILLING VIBRATE BIND_APPHUB_SERVICE ACCESS_WIFI_STATE WAKE_LOCK BIND_GET_INSTALL_REFERRER_SERVICE ACCESS_ADSERVICES_AD_ID READ_GSERVICES FOREGROUND_SERVICE DYNAMIC_RECEIVER_NOT_EXPORTED_PERMISSION CHECK_LICENSE
Permission Text OTHER:
OTHER:
Allows applications to open network sockets.
Allows applications to access information about networks.
Allows access to the vibrator.
Allows applications to access information about Wi-Fi networks.
Allows using PowerManager WakeLocks to keep processor from sleeping or screen from dimming.
Min Sdk24
Min Sdk TxtAndroid 7.0 (N)
Target Sdk35
Target Sdk Txt35
Multi WindowNo
Supports Screenssmall, normal, large, xlarge
CPUarm64-v8a
Open GL Int0
Supports Any DensityYes
Densities120, 160, 240, 320, 480, 640, 65534, 65535

// User Features //

Uses Feature Wi-Fi hardware features:
The app uses 802.11 networking (Wi-Fi) features on the device.
Uses Feature Touchscreen hardware features:
The app uses the Global System for Mobile Communications (GSM) telephony radio system.
The app uses the device's basic two-point multitouch capabilities, such as for pinch gestures, but the app does not need to track touches independently. This is a superset of the android.hardware.touchscreen feature.
The app uses the device's advanced multitouch capabilities for tracking two or more points independently. This feature is a superset of the android.hardware.touchscreen.multitouch feature.
Uses Feature The app uses 802.11 networking (Wi-Fi) features on the device.#:

// Signature //

Md57B24D024D501B6FB77B6AE095340E559
SignatureFCA3D6A27DD90DDF78FFD2F0E58591108120138B
Sha2562254EA6BA980BAF3D8C401B014517D0D3367E3BAAAF3F632E6DA37C26F4982E1
Valid FromTue Aug 12 09:50:01 CEST 2025 until: Sat Dec 28 08:50:01 CET 2052
Serial Numberc33701c02a6d2437

// Developer //

Developerusa
OUu
OrganizationO
Localemsk
Countryusa
Citystr

# What're users talking about #DRIVE Mod APK

Download HappyMod to join real time talk with millions of users.

  • User reviews
  • User requests

Write a review for #DRIVE Mod APK

Rate it:

Average rating out of 46

5.0
Submit a review

User reviews (46)

P

@Anonymous   2026-01-12 22:41:36

From:PK   Device:23106RN0DA   OS:android 15
not working, I have tried there four times but it didn't work.

D

@Anonymous   2025-12-31 00:15:52

From:DZ   Device:M2012K11AG   OS:android 13
it works perfectly without any problems

A

@Anonymous   2025-12-11 23:24:58

From:AU   Device:SM-G991B   OS:android 15
good game but can't get extras

U

@Anonymous   2025-09-11 01:27:31

From:US   Device:CPH1911   OS:android 10
there's no unlimited money just the usual game

I

@Anonymous   2025-07-05 21:12:21

From:IN   Device:2406ERN9CI   OS:android 15
its a very nice game

P

@Anonymous   2025-05-15 20:30:52

From:PK   Device:V2352   OS:android 14
this is so nice game

U

@Anonymous   2025-05-05 02:00:45

From:US   Device:moto g04   OS:android 14
she's, eating dinner

U

@Anonymous   2025-04-23 16:45:47

From:US   Device:TECNO BF7   OS:android 12
It works. A little sketchy but no virus and all.

U

@Anonymous   2025-04-07 22:06:09

From:US   Device:SM-A146U   OS:android 14
This Mod definitely works ?. I'm having a lot of fun on this game ?

G

@Anonymous   2025-03-18 12:01:33

From:GB   Device:RMX2050   OS:android 11
Hii

I

@Anonymous   2025-03-05 23:20:56

From:IN   Device:2312DRA50I   OS:android 14
works

E

@Anonymous   2025-03-05 00:59:27

From:EG   Device:ALI-NX1   OS:android 14
تمام

I

@Anonymous   2025-03-03 16:36:13

From:IN   Device:moto g84 5G   OS:android 14
best

G

@Anonymous   2025-02-28 16:37:33

From:GB   Device:SM-G955F   OS:android 8.0.0
1 outa 10 almost died? The problem is that the game its JUST the freaking loaging screen....

U

@Anonymous   2025-02-23 12:34:31

From:US   Device:V2249   OS:android 14
nice

U

@Anonymous   2025-02-23 07:50:43

From:US   Device:M2006C3LG   OS:android 11
did not work

U

@Anonymous   2025-02-23 07:50:25

From:US   Device:M2006C3LG   OS:android 11
wouldn't work

G

@Anonymous   2025-02-17 23:50:59

From:GB   Device:RMX3842   OS:android 15
100% working mod

U

@Anonymous   2025-02-15 23:21:12

From:US   Device:2306EPN60G   OS:android 15
buttons don't work sometimes

G

@Anonymous   2025-02-10 17:55:52

From:GB   Device:CPH1909   OS:android 8.1.0
#Drive has new update Halloween new a cars free I have a map to now!

More...[+]

Request a latest version of #DRIVE Mod

If this mod doesn't work, you can send a request to HappyMod community. Users will upload a new mod if they've one.
Send a request

Latest requests related to #DRIVE

E

@Anonymous   2022-04-09 03:07:37

From:EG   Device:Xiaomi M2010J19SG   OS:android 10
نطالب بهاذه العبه .....................................

I

@Anonymous   2022-03-26 17:50:46

From:ID   Device:samsung SM-A025F   OS:android 11
citttt plesssssss.!.!.!.!.!.!.!.!.!.!.!.!.!.!.!!.!.!.!.!.!.!.!.!.!.!.!.!.!.!.!.!.!.!.!.!.!.!.!.!.!.!.!.!.!.!.!.!.!.!.!.!.!.!.!.!.!.!.!.!.!.!.!.!.!.!.! a a a a aa a a

F

@Anonymous   2022-02-23 17:05:19

From:FR   Device:samsung SM-J720F   OS:android 10
argent et gem illimité débloqué toutes les voitures

R

@Anonymous   2022-02-15 20:57:40

From:RU   Device:samsung SM-A105F   OS:android 11
надо мод на взлом ттттттттттттттттттттттттттттттттттттттттттттттттттттттттт

T

@Anonymous   2022-01-22 17:25:38

From:TR   Device:LGE LG-K430   OS:android 6.0
jxöcmvşv övçvlrşfşvkgşgşfdmşfrödptşt993ü28t9494prğelö3rl rltmtkemjtk3738p373o3ğ2ptorr9rkr 4o4prktrşotmgştktöfo39rnfşfop48toşvmdfmmfrmk3kfnvmmfmfmgmföfödlelföögöföcdöxööxödöxlxöxm

G

@Anonymous   2021-12-22 23:17:25

From:GB   Device:HMD Global Nokia 1.3   OS:android 11
please add this hhhhhhhhhhhh ygfyjfudfufbrunfincurnceycnurnfurnfcnurjrjcwygkwyyhjhkrytehkteeykgyeeyhkwthketkheyhkwtetkethketbktebkyekheygmwygkwykvwtnvtwgkwtvmetjgwtgkwtkgwtgkwtgktwgkwtgkwtvmtwmvtwgmtwvmwtgktwmgeykgygjeyjfye CV

U

@Anonymous   2021-12-07 06:34:05

From:US   Device:samsung SM-G928V   OS:android 6.0.1
plz add unlimited coins and add no ads and unlimited windsheilds like the thing to revive you if you do this thanks

O

@Anonymous   2021-11-20 23:40:38

From:OM   Device:HUAWEI JKM-LX1   OS:android 9
السلام عليكم ورحمه الله تعالى وبركاته اتمنى لكم التوفيق

U

@Anonymous   2021-11-03 22:50:28

From:US   Device:OPPO CPH2285   OS:android 11
...................................................... unlimited money . unlimited fuel ⛽

E

@Anonymous   2021-10-30 16:31:14

From:ES   Device:Xiaomi Redmi 7A   OS:android 10
I want infinite money and that all The Cars are unlocked.

E

@Anonymous   2021-09-15 08:24:42

From:ES   Device:samsung SM-A015M   OS:android 11
hola, encontré este juego en la play store y me gustó mucho pero se hace un poco pesado el subir de level y conseguir dinero para comprar los autos así que un mod para este juego estaría muy bien

A

@Anonymous   2021-09-04 02:30:37

From:AU   Device:samsung SM-A705FN   OS:android 11
unlimited money pls it will be good game and fun game

P

@Anonymous   2021-08-03 02:44:37

From:PL   Device:Xiaomi M2006C3MNG   OS:android 10
nieskończone pieniądze, odblokowane pojazdy, bardzo prosze o zrobienie moda do tej gry.

G

@Anonymous   2021-06-28 02:11:16

From:GB   Device:samsung SM-A715F   OS:android 11
please release all cars so that we can have more fun

B

@Anonymous   2021-06-10 03:33:54

From:BR   Device:samsung SM-G570M   OS:android 8.0.0
eu quero eu quero eu quero eu quero quero eu quero eu quero eu

G

@Anonymous   2021-05-10 13:05:21

From:GB   Device:HUAWEI EVA-L19   OS:android 7.0
get a mod on this application since I want the free shopping and mod money

U

@Anonymous   2021-05-07 23:31:43

From:US   Device:samsung SM-G930T   OS:android 8.0.0
Smth like mod money and coins, and it they find a way then they can make all in-game purchases free

U

@Anonymous   2021-04-16 01:30:14

From:US   Device:LGE LM-Q730   OS:android 10
come on 50 character minimum? what are we, twelve?

B

@Anonymous   2021-03-14 10:14:35

From:BR   Device:samsung SM-J610G   OS:android 10
onde Menu ou mod dinheiro e traduzir .

E

@Anonymous   2021-02-04 17:26:31

From:EG   Device:realme RMX2020   OS:android 10
عملات غش تهكير نسينيننينسنيزيزسززسسزسززسزسزسزسوسوسوسوسوسوسووسو

More...[+]

Logo

HappyMod

Best mod downloader
for 100% working mods.

#DRIVE Mod apk ~ download faster with HappyMod.

Other Versions

Found (239) versions of #DRIVE Mod

#DRIVE Mod Apk [Free purchase][Free shopping][Unlocked]

#DRIVE Mod Apk [Free purchase][Free shopping][Unlocked]

Free Shopping , Unlock all levels , Save Edito
No Ads
Mod Menu
#DRIVE Mod Apk [Unlocked]

#DRIVE Mod Apk [Unlocked]

Unlock all vehicles, skins, race tracks
#DRIVE Mod Apk [Unlocked]

#DRIVE Mod Apk [Unlocked]

Unlock all vehicles, skins, race tracks
No Ads
Mod Menu

#DRIVE Mod Apk [Unlocked]

Unlock all vehicles, skins, race tracks
No Ads
Mod Menu

#DRIVE Mod Apk [Unlocked]

Unlock all vehicles, skins, race tracks
No Ads
Mod Menu

#DRIVE Mod Apk [Unlocked]

Unlock all vehicles, skins, race tracks
No Ads
Mod Menu

#DRIVE Mod Apk [Unlocked]

Unlock all vehicles, skins, race tracks
No Ads
Mod Menu

#DRIVE Mod Apk [Unlocked]

Unlock all vehicles, skins, race tracks
No Ads
Mod Menu

#DRIVE Mod Apk [Unlocked]

Unlock all vehicles, skins, race tracks
No Ads
Mod Menu

#DRIVE Mod Apk [Unlocked]

Unlock all vehicles, skins, race tracks
No Ads
Mod Menu

#DRIVE Mod Apk [Unlocked]

Unlock all vehicles, skins, race tracks
No Ads
Mod Menu

#DRIVE Mod Apk [Unlocked]

Unlock all vehicles, skins, race tracks

#DRIVE Mod Apk [Unlocked]

Unlock all vehicles, skins, race tracks
No Ads
Mod Menu

#DRIVE Mod Apk [Unlocked]

Unlock all vehicles, skins, race tracks

#DRIVE Mod Apk [Unlocked]

Unlock all vehicles, skins, race tracks

#DRIVE Mod Apk [Unlocked]

Unlock all vehicles, skins, race tracks

More...[+]

Other Apps from this developer

Explore more great apps from the same developer...

Ski Jump Mod Apk 3.52 [Unlimited money]

Ski Jump Mod Apk 3.52 [Unlimited money]

The game modified gold coins is 999999999 you!