Chicken Gun Mod

Chicken Gun Mod APK 5.1.01 [Unlimited money]

100% working

Trusted   Update on: 2025-10-24

  • Video preview
  • Chicken Gun screenshots
  • Chicken Gun screenshots
  • Chicken Gun screenshots
  • Chicken Gun screenshots
  • Chicken Gun screenshots
App nameChicken Gun Mod APK 5.1.01 [Unlimited money]
Version5.1.01
Update on2025-10-24
Size831.06 MB
Price Free
Rating 3.0
SystemAndroid 6.0 (M)
Mod info Unlimited money
Developer
Category Action
Get it on Google Play
Download original apk
Share
Download Links:

Chicken Gun Mod APK 5.1.01 [Unlimited money]

Use HappyMod App to get faster download!
You can still download from this domain (happymod.to) for now, but we strongly recommend switching to our new official domain for future updates and support: Download Chicken Gun at HappyMod.net.
* All mod apks are uploaded by users. If there is any infringement, please contact us to remove it.

# Mod Info

The main advantages / modifications of Chicken Gun Mod APK 5.1.01 [Unlimited money]

Video Verified

MOD, Unlimited Coins
No Ads
Mod Menu

# Chicken Gun Mod APK 5.1.01 [Unlimited money] Features:

Armed chickens shoot and fight with each other. Shooting on the network with two modes, 5 vs 5 and against all. You can cool your rooster, weapon, beak, sneakers and caps. Throw explosive eggs and arrange a slaughter. Join to chickens firefight.

# How to download and install Chicken Gun Mod APK 5.1.01 [Unlimited money]?

// Option A //

To download Chicken Gun mod from HappyMod.to.
You need enable the option "Unknown Sources".
1. Click on the above link to download Chicken Gun mod APK.
2. Save the file in your device Downloads folder.
3. Now tap on Install and wait for the installation to finish.
4. Once it is done, open the game and start playing it right away.

// Option B //

To download Chicken Gun from HappyMod APP, you can follow this:
1. Open your browser and download the HappyMod APK file from HappyMod.to - the only official website of HappyMod.
2. Open Android Settings and go into Privacy or Security.
3. Tap the option to Allow Unknown Sources and enable it.
4. Go to your Android downloads and tap the APK file.
5. Follow the directions on the screen to install it.
6. Search Chicken Gun in HappyMod App.

# Full Specifications of Chicken Gun Mod APK 5.1.01 [Unlimited money]

// Download Information //

Size831.1MB
Version4.9.02
Version Code360
Langaf af-ZA am ar as az be bg bn bn-BD bn-IN bs ca cs da de de-AT de-DE el en en-AU en-CA en-GB en-IN en-XC es es-US et eu fa fi fr fr-CA fr-FR gl gu he hi hr hu hy id in is it it-IT iw ja ja-JP ka kk km kn ko ko-KR ky lo lt lv mk ml mn mr ms my nb ne nl or pa phi pl pt pt-BR pt-PT ro ro-RO ru ru-RU si sk sl sq sr sr-Latn sr-RS sv sw ta te th tl tr tr-TR tw uk ur ur-PK uz uz-UZ vi zh zh-CN zh-HK zh-MO zh-TW zu

More...[+]

// Operation Systems //

PermissionINTERNET ACCESS_NETWORK_STATE ACCESS_WIFI_STATE AD_ID WAKE_LOCK FOREGROUND_SERVICE FOREGROUND_SERVICE_DATA_SYNC BILLING BIND_APPHUB_SERVICE ACCESS_ADSERVICES_ATTRIBUTION ACCESS_ADSERVICES_TOPICS BIND_GET_INSTALL_REFERRER_SERVICE ACCESS_ADSERVICES_AD_ID DYNAMIC_RECEIVER_NOT_EXPORTED_PERMISSION READ_APP_INFO GET_COMMON_DATA CHECK_LICENSE
Permission Text OTHER:
OTHER:
Allows applications to open network sockets.
Allows applications to access information about networks.
Allows applications to access information about Wi-Fi networks.
Allows using PowerManager WakeLocks to keep processor from sleeping or screen from dimming.
Min Sdk23
Min Sdk TxtAndroid 6.0 (M)
Target Sdk35
Target Sdk Txt35
Multi WindowNo
Supports Screenssmall, normal, large, xlarge
CPUarm64-v8a armeabi-v7a
Open GL Int0
Supports Any DensityYes
Densities120, 160, 240, 320, 480, 640, 65534, 65535

// User Features //

Uses Feature Wi-Fi hardware features:
The app uses 802.11 networking (Wi-Fi) features on the device.
Uses Feature Touchscreen hardware features:
The app uses the Global System for Mobile Communications (GSM) telephony radio system.
The app uses the device's basic two-point multitouch capabilities, such as for pinch gestures, but the app does not need to track touches independently. This is a superset of the android.hardware.touchscreen feature.
The app uses the device's advanced multitouch capabilities for tracking two or more points independently. This feature is a superset of the android.hardware.touchscreen.multitouch feature.
Uses Feature other.#The app requires the device to use the portrait or landscape orientation. If your app supports both orientations, then you don't need to declare either feature.#The app uses 802.11 networking (Wi-Fi) features on the device.#:

// Signature //

Md55C916AAA87333FD210416E1D35BE7192
Signature166A1386B39CC5C9608392342E249D86BCE81B6E
Sha2560F01526F0AA35D6898D7DA669B8A2883E2859CB9E8D1E54B63F15D93B2631B76
Valid FromThu Aug 14 08:13:41 CEST 2025 until: Mon Dec 30 07:13:41 CET 2052
Serial Number2ce7975f8f83d0d8

// Developer //

Developerusa
OUu
OrganizationO
Localemsk
Countryusa
Citystr

# Chicken Gun FAQ


Why can't I buy cars, planes, and animals?


If you're unable to purchase cars, planes, or animals, it may be due to a bug in the game. Ensure you have enough in-game currency and try restarting the game.



Why does my gun not appear in my inventory after purchase?


If your gun isn't showing up in your inventory, it could be a glitch. Make sure to check your inventory after restarting the game.



Can I buy multiple guns?


Currently, the mod allows you to purchase only one gun at a time. If you want to buy another, you need to either sell or discard the one you have.

To buy another gun, you must first remove the existing one from your inventory. This limitation is likely a design choice to balance gameplay.

Steps to resolve:
1. Open your inventory.
2. Select the gun you want to remove.
3. Choose the option to sell or discard it.
4. Once removed, you can purchase a new gun.



What should I do if the mod menu doesn't work?


If the mod menu isn't functioning, try restarting the game or checking for any updates that may fix the issue.

Sometimes, the mod menu may not respond due to temporary glitches. Restarting the game can refresh the mod's functionality.

Steps to resolve:
1. Save your current game progress.
2. Exit the game completely.
3. Relaunch the game.
4. Check if the mod menu is now working.



Why do I see 'No tiene armas desbloqueadas'?


This message indicates that you haven't unlocked any weapons yet. You need to progress in the game to unlock more weapons.

Unlocking weapons typically requires completing certain missions or reaching specific levels. Focus on gameplay objectives to gain access to new weapons.

Steps to resolve:
1. Complete initial missions or tasks.
2. Earn in-game currency or points.
3. Visit the weapon shop to see available options.
4. Purchase unlocked weapons as you progress.



Why are the weapons not appearing in my inventory?


Some users have reported issues with weapons not showing up in their inventory after purchase. This may be due to a glitch in the mod.

If your weapons are not appearing, it could be a temporary issue with the mod's functionality. Restarting the game or reloading your inventory might help.

Steps to resolve:
1. Exit the game completely.
2. Restart your device.
3. Open the game again.
4. Check your inventory to see if the weapons appear.



Why can't I buy items in the mod?


Some users have experienced difficulties when trying to purchase items, which may be related to the mod's current state or a bug.

If you are unable to buy items, ensure that you have enough in-game currency and try refreshing the mod. Sometimes, a simple refresh can resolve the issue.

Steps to resolve:
1. Check your in-game currency balance.
2. Close the mod and reopen it.
3. Attempt to make the purchase again.



Why do some of my purchases not save?


There are reports of items not saving after purchase, which can be frustrating for players.

This issue may occur due to a syncing problem within the mod. To improve the chances of saving your purchases, try the following steps.

Steps to resolve:
1. Make sure you are connected to a stable internet connection.
2. Purchase items one at a time instead of in bulk.
3. After each purchase, check if the item appears in your inventory.



Why don't the purchased weapons appear in my inventory?


Purchased weapons may not save properly due to a conflict in the mod. This can happen if the mod is not fully compatible with the game version.

To resolve this, ensure that you are using the latest version of the mod. Sometimes, reinstalling the mod can help fix inventory issues.

Steps to resolve:
1. Uninstall the current mod from your device.
2. Download the latest version of the mod.
3. Install the mod again and launch the game.
4. Check if the weapons now appear in your inventory.



Why can't I equip the weapons I bought?


Weapons may not equip due to a bug in the mod or a conflict with the game settings.

If you are unable to equip weapons, try restarting the game after purchasing them. This can refresh the inventory and allow you to equip the items.

Steps to resolve:
1. Purchase the desired weapon in the game.
2. Exit the game completely.
3. Restart the game and check your inventory.
4. Try to equip the weapon again.



Why do I only have one weapon available to choose from?


The mod may limit weapon selection due to its design or a bug that prevents multiple weapons from being accessible.

To access more weapons, ensure that you have purchased them correctly and check if there are any settings in the mod that allow for multiple selections. Sometimes, a game restart can also help.



What should I do if I encounter a conflict with a package?


A package conflict can prevent the mod from functioning correctly. This usually indicates that another mod or game version is interfering.

To fix this, try removing any other mods you have installed and ensure that the game is updated to the latest version. Restarting your device may also help clear conflicts.

# What're users talking about Chicken Gun Mod APK

Download HappyMod to join real time talk with millions of users.

  • User reviews
  • User requests

Write a review for Chicken Gun Mod APK

Rate it:

Average rating out of 148

3.0
Submit a review

User reviews (148)

M

@Anonymous   2026-02-09 20:22:37

From:MM   Device:SM-A055F   OS:android 14
good game to play for fun

U

@Anonymous   2026-01-28 17:41:40

From:US   Device:CPH1969   OS:android 11
Can you fix the weapon??? when I buy 2 weapons, and play, and check the inventory... it just a default weapons, I don't see a weapon that I buyed please fix it :((

G

@Anonymous   2025-12-28 14:43:45

From:GB   Device:220333QNY   OS:android 13
thank you for this mod

K

@Anonymous   2025-12-26 15:12:01

From:KZ   Device:SM-T225   OS:android 14
it's cool bro thank you

U

@Anonymous   2025-12-26 08:25:02

From:UA   Device:SM-G991U   OS:android 15
The things I buy in the store disappear instantly and I can't use them in the game.

B

@Anonymous   2025-12-24 00:42:48

From:BD   Device:SM-S916U   OS:android 13
I keep buying stuff but it doesn't equip

C

@Anonymous   2025-12-20 04:32:50

From:CZ   Device:25057RN09E   OS:android 15
it won't let me install it bro I deleted every game thinking it was install even my 6 year progress and still it doesn't work how do I fix this

U

@Anonymous   2025-12-15 09:07:37

From:US   Device:TB373FU   OS:android 15
the mod works perfectly I just wouldn't recommend doing this because of hackers just crashing servers which makes the game extra boring

I

@Anonymous   2025-12-14 18:42:08

From:IN   Device:RMX3761   OS:android 15
it's not installing at all

U

@Anonymous   2025-12-14 13:37:24

From:US   Device:SM-G975U   OS:android 12
this game don't let me in

U

@Anonymous   2025-12-13 18:23:53

From:US   Device:Infinix X669C   OS:android 12
best mod ever infinite money is amazing

U

@Anonymous   2025-12-11 18:43:07

From:US   Device:vivo 1906   OS:android 11
I can't even buy weapons when I'm in the game the weapon all gone

M

@Anonymous   2025-12-10 18:25:28

From:MY   Device:RMX3939   OS:android 14
i cant buy weapons please fix

G

@Anonymous   2025-12-08 00:05:14

From:GB   Device:MAR-LX1A   OS:android 10
I cant download it fix it

M

@Anonymous   2025-12-06 14:30:14

From:MY   Device:YAL-L21   OS:android 10
the app won't install

M

@Anonymous   2025-12-06 10:56:39

From:MY   Device:M2010J19SG   OS:android 12
i keep buying stuff and i cant equip it somehow

L

@Anonymous   2025-12-02 19:48:13

From:LT   Device:SM-S906B   OS:android 16
I cant buy any items

P

@Anonymous   2025-12-01 10:49:59

From:PH   Device:CPH2641   OS:android 15
best game no crashes, no laggy Ping

P

@Anonymous   2025-11-29 12:27:55

From:PH   Device:NDL-W09   OS:android 14
why is it not working

P

@Anonymous   2025-11-26 20:39:12

From:PH   Device:AQM-LX1   OS:android 10
This mod is really good I can buy stuff what I want

More...[+]

Request a latest version of Chicken Gun Mod

If this mod doesn't work, you can send a request to HappyMod community. Users will upload a new mod if they've one.
Send a request

Latest requests related to Chicken Gun

U

@Anonymous   2023-03-17 08:54:01

From:US   Device:Xiaomi M2006C3LG   OS:android 11
sidjwnenjwwkfnrndfnd is cooler uwdjfkwkfnendnfdnfmfmfmfmffmgmrmvmrkfoeoeoworoirg

R

@Anonymous   2023-03-12 00:16:36

From:RU   Device:Xiaomi 220333QNY   OS:android 11
ПЖ ДОБАВЬТЕ ЧИТЫ ОТ Lary Hacker! скучно просто с деньгами! не можешь бесить игроков

P

@Anonymous   2023-03-10 19:05:17

From:PH   Device:samsung SM-A217F   OS:android 12
max level infinite money mega menu mod please please

U

@Anonymous   2023-03-06 11:10:07

From:US   Device:samsung SM-A307G   OS:android 11
matar a todos con un solo clic y dinero eliminado

M

@Anonymous   2023-03-06 01:40:40

From:MX   Device:Xiaomi 220733SL   OS:android 12
XD ohrheieveurirgrir9rcroevrvdihrudhdofjdccicvsidifjrjdhrbrh

D

@Anonymous   2023-03-04 10:02:33

From:DO   Device:samsung SM-N950U1   OS:android 9
ta bien funciona pero algo malo esque no es infinito pero tiene sentido

B

@Anonymous   2023-02-14 02:08:39

From:BR   Device:samsung SM-J410G   OS:android 8.1.0
ta falando ta que o app não foi possível instalar

B

@Anonymous   2023-02-11 01:05:56

From:BR   Device:samsung SM-A037M   OS:android 12
imunidade a tudooooooooooooooooooooooooooooooooooooo

I

@Anonymous   2023-02-10 18:00:10

From:IT   Device:samsung SM-A105FN   OS:android 11
add this version why chaloaps is add a new update pls add this version

A

@Anonymous   2023-02-10 01:05:00

From:AE   Device:samsung SM-T290   OS:android 11
ارجو تنزيل التحديث 3.2.06 ارجووووووووووووووووووووووووووووو

G

@Anonymous   2023-02-08 18:16:36

From:GB   Device:samsung SM-A107F   OS:android 11
We all know happy mod he try lie us this game chicken gun problem is not update but and real update is new that is not cool happymod he care and lie so if you trust him that will when wrong this is not update bro is real update go see update this is wrong

R

@Anonymous   2023-02-04 21:26:28

From:RO   Device:motorola moto e(7) power   OS:android 10
plzz chicken gun v3.2.04 money mod plzzzzzzzzzzzzzzzz

A

@Anonymous   2023-02-01 09:52:56

From:AR   Device:alps TabletEXO_Wave_i101S   OS:android 11
mucho moneda mod menu funcionable 100%.

P

@Anonymous   2023-01-29 16:15:57

From:PH   Device:samsung SM-A107F   OS:android 11
app not installed gun back kshskdkdkekekekekeejskekwkkrekek

R

@Anonymous   2023-01-25 15:06:55

From:RU   Device:samsung SM-A037F   OS:android 13
мод меню красивый спавнер оружие гугл авторизоваться скачать без рут

R

@Anonymous   2023-01-23 12:44:31

From:RU   Device:realme RMX2001   OS:android 11
перед тем как скачать мод удалите ориг. чикен ган Мод бессмертие бесконечные деньги много патронов много гранат разблокировать все анти Кик Кикнуть всех масс килл остановить всех респавн бесконечное топливо джет пака урон и т.д.

G

@Anonymous   2023-01-18 22:32:02

From:GB   Device:HUAWEI DRA-LX9   OS:android 10
Pls mod menu ok too chicken gun mod menu

R

@Anonymous   2023-01-18 15:17:06

From:RU   Device:vivo vivo 1820   OS:android 8.1.0
MOD MENU rjnfmrdkkddkldkdkdkdkfjfjfjfkfjrjfkfjjf kddjdjfjfkjg rjjfkfgjgjjgjfjfxjjcfb

U

@Anonymous   2023-01-12 15:48:54

From:US   Device:samsung SM-T500   OS:android 11
i want god mode and also unlimited money,add points and 1 hit shnsehwuuwusuchdjduduc

A

@Anonymous   2023-01-07 05:42:12

From:AR   Device:motorola moto e(7i) power   OS:android 10
me gustaría chicken gun en el cual sea accesible para todos y que no tenga virus y que tenga un mod y god mode que se desactiva y que tenga mucho dinero

More...[+]

Logo

HappyMod

Best mod downloader
for 100% working mods.

Chicken Gun Mod apk ~ download faster with HappyMod.

Other Versions

Found (90) versions of Chicken Gun Mod

Chicken Gun Mod Apk [Unlimited money]

Chicken Gun Mod Apk [Unlimited money]

MOD, Unlimited Coins
No Ads
Mod Menu
Chicken Gun Mod Apk [Unlimited money]

Chicken Gun Mod Apk [Unlimited money]

MOD, Unlimited Coins
No Ads
Mod Menu
Chicken Gun Mod Apk [Unlimited money]

Chicken Gun Mod Apk [Unlimited money]

MOD, Unlimited Coins
No Ads
Mod Menu
Chicken Gun Mod Apk [Unlimited money][Unlocked][Plus][Mega mod][Mod Menu][High Damage]

Chicken Gun Mod Apk [Unlimited money][Unlocked][Plus][Mega mod][Mod Menu][High Damage]

MEGA MOD MENU
Unlimited Coins
MAX Level
MAX EXP
All Unlocked
High Damage
Rapid Fire
No Kick
No Ban
Plus Many More Features!

Chicken Gun Mod Apk [Unlimited money]

MOD, Unlimited Coins
No Ads
Mod Menu

Chicken Gun Mod Apk [Unlimited money]

MOD, Unlimited Coins
No Ads
Mod Menu

Chicken Gun Mod Apk [Unlimited money]

MOD, Unlimited Coins
No Ads
Mod Menu

Chicken Gun Mod Apk [Unlimited money]

MOD, Unlimited Coins
No Ads
Mod Menu

Chicken Gun Mod Apk [Unlimited money]

MOD, Unlimited Coins
No Ads
Mod Menu

Chicken Gun Mod Apk [Unlimited money]

MOD, Unlimited Coins
No Ads
Mod Menu

Chicken Gun Mod Apk [Unlimited money]

MOD, Unlimited Coins
No Ads
Mod Menu

More...[+]

Related Mods

People who download Chicken Gun Mod also like...

Other Apps from this developer

Explore more great apps from the same developer...