Clash Royale Mod

Clash Royale Mod APK 130300006 [Unlimited money]

100% working

Trusted   Update on: 2025-10-09

  • Video preview
  • Clash Royale screenshots
  • Clash Royale screenshots
  • Clash Royale screenshots
  • Clash Royale screenshots
  • Clash Royale screenshots
App nameClash Royale Mod APK 130300006 [Unlimited money]
Version130300006
Update on2025-10-09
Size920.77 MB
Price Free
Rating 3.6
SystemAndroid 5.0 (LOLLIPOP)
Mod info Unlimited money
Developer
Category Strategy
Get it on Google Play
Download original apk
Share
Download Links:

Clash Royale Mod APK 130300006 [Unlimited money]

Use HappyMod App to get faster download!
You can still download from this domain (happymod.to) for now, but we strongly recommend switching to our new official domain for future updates and support: Download Clash Royale at HappyMod.net.
* All mod apks are uploaded by users. If there is any infringement, please contact us to remove it.

# Mod Info

The main advantages / modifications of Clash Royale Mod APK 130300006 [Unlimited money]

Video Verified

Unlimited Crystals
Unlimited Coins
Private Serve

# Real-Time PvP

Real-Time PvP captures the core excitement of Clash Royale by pitting two players against each other in live, fast-paced matches that demand quick thinking, accurate timing, and adaptive tactics. Each battle happens in real time, so decisions are immediate and consequences are direct. Players must place cards, manage elixir, and respond to enemy moves on the fly, turning every match into a dynamic mind game where prediction and adaptability matter as much as raw power. The real-time nature amplifies tension: a single misplaced troop or delayed counter can swing the momentum and determine victory or defeat. Because matches are short, typically lasting a couple of minutes with overtime in close games, the format rewards concise planning, quick learning, and clutch plays. The game balances urgency with depth by offering a wide range of card interactions, counterplay, and strategic diversity. You will encounter both classic archetypes and creative, unexpected decks, forcing you to refine your reading of opponents and to practice flexible responses. Real-Time PvP also provides a social and competitive framework: each match can feel like a head-to-head duel with narrative stakes tied to League standings, Arena progression, and leaderboard positions. Players earn trophies and progress through Arenas after each victory, which fuels continuous improvement and engagement. The matchmaking system pairs you with opponents of comparable skill, making each session a meaningful test of your current deck and reaction skills. For players who enjoy live competition, the format offers constant variety because human opponents rarely play the same way twice. Real-Time PvP is not only about individual plays; it creates emergent strategic trends as communities and top players discover new tactics, which then filter down through the player base. That keeps the meta evolving and the gameplay fresh. Whether you are improvising an unexpected counter, executing a timed push, or carefully baiting spells to break through defenses, the real-time PvP battles in Clash Royale deliver a compact, intense, and endlessly replayable competitive experience.
  • Immediate decisionmaking:Matches are fast and require instant placement and response to enemy actions
  • Momentum swing:A single misplay or well-timed counter can change the outcome of the entire match
  • Short tense sessions:Games last minutes and reward concise strategies and clutch execution
  • Evolving meta:Human opponents and community developments create shifting strategic trends

# Deck Building

Deck Building in Clash Royale is a strategic craft that blends creativity with rigorous planning. Players assemble an eight-card Battle Deck before entering the Arena, and every choice influences tempo, synergy, and available counters. A well-constructed deck balances offense, defense, elixir curve, and win conditions, whether that means crafting heavy beatdown lists, fast cycle decks, control builds, or hybrid strategies. The process begins with selecting a win condition, such as a massive tank, a glass cannon carry, or continuous chip damage, and then surrounding that core with supporting troops, spells, and defensive options that protect and amplify the main plan. Players must also design a smooth elixir curve so they can respond in early, mid, and late stages of the match without being starved. Good deck building anticipates common threats and integrates answers like spells or counters, while minimizing obvious weaknesses. Balancing redundancy and variety is important: some direct counters allow flexibility, while complementary cards supply multiple solutions to similar problems. Because cards level up and new cards unlock as you progress through Arenas, deck design is dynamic; you will iterate decks as you collect cards and adapt to the prevailing meta. Practice and experimentation are necessary: testing a deck in multiple matchups reveals hidden gaps and helps refine card choices and play priorities. Additionally, deck building supports personal playstyle expression; some players value high-risk high-reward combos while others prefer disciplined control. The system rewards learning and adaptation: mastering deck building improves your ability to predict opponent behavior, manage resources, and make meaningful tradeoffs in-game. Clanmates and community resources provide further support through shared decks and feedback, accelerating improvement. Ultimately, deck building is both the strategic backbone and creative outlet of Clash Royale, encouraging players to think several steps ahead and to continually refine their approach in pursuit of consistent wins.
  • Win condition focus:Choose a central strategy like beatdown, cycle, control, or chip and build around it
  • Elixir curve management:Balance early, mid, and late game tools to avoid being overwhelmed or starved
  • Counters and redundancy:Include versatile answers to common threats and multiple ways to handle the same problem
  • Iterative testing:Refine decks through matches, community feedback, and adaptation to the meta

# Tower Defense

Tower Defense is a foundational gameplay element in Clash Royale where the objective is to protect your King and Princess Towers while dismantling the opponent's defenses. Each player controls three towers, and the strategic placement of troops and spells determines how effectively you can defend and punish enemy advances. Unlike traditional tower defense games, Clash Royale combines mobile troop deployment with card-driven mechanics, so players must reconcile limited elixir resources with precise positioning. Defensive play involves learning how to trade tower damage, bait out costly spells, and lure enemy troops into inefficient paths. Proper defense often creates counterattack opportunities: a successful block or cost-effective trade lets you turn defense into offense, sending surviving units toward an enemy tower with momentum. Map awareness matters as well; understanding spawn positions, troop targeting priorities, and tower aggro enables players to funnel enemies into kill zones or to protect high-value defensive structures. Upgrading towers visually and strategically through seasonal skins or cosmetic changes does not affect core defense mechanics but can affect player focus and identity in-game. As players climb Arenas, defensive expectations rise because opponents bring stronger combos and coordinated pushes that test your reaction time and planning. Tower Defense in Clash Royale is not about passivity; it is a dynamic, tactical system that rewards proactive anticipation and calculated risk. Effective defenders make judicious use of spells to clear swarms, rely on chipping and splashing units to manage multiple threats, and maintain elixir parity to avoid being overwhelmed. Over time, mastering tower defense includes recognizing tempo shifts, managing double elixir periods, and knowing when to sacrifice a tower to secure victory elsewhere. The blend of offense and defense, combined with fast rounds, makes tower defense a thrilling and cerebral component of the overall competitive experience.
  • Trade and tempo:Efficient defensive trades create opportunities for counter pushes and positive elixir swings
  • Placement and pathing:Proper troop placement manipulates targeting and funnels enemies into disadvantageous routes
  • Spell management:Using spells at the right moment clears threats and protects towers from mass damage
  • Double elixir adaptation:Defense strategies shift when elixir generation increases, enabling bigger counters and pushes

# Card Collection

Card Collection is central to progression in Clash Royale, letting players unlock, upgrade, and refine the roster of over 100 unique cards that represent troops, spells, and buildings. Collecting cards is both a strategic and motivational loop: new cards expand deck possibilities and introduce novel interactions, while upgrades increase card power and enable competitiveness in higher Arenas. Players obtain cards through chests, shop offers, seasonal rewards, and clan donations, creating multiple pathways to bolster a collection. Rarity tiers—Common, Rare, Epic, and Legendary—shape acquisition rates and upgrade costs, which encourages long-term planning about which cards to prioritize. Managing resources like gold and card fragments becomes essential as you decide which upgrades yield the most impact for your deck and playstyle. The collection serves as a sandbox for creativity: combining unexpected cards can produce surprising synergies or counter-meta strategies that catch opponents off-guard. It also fuels social mechanics—sharing cards within your Clan speeds up upgrades and fosters cooperative progression. A robust collection unlocks access to diverse archetypes, from heavy tanks to glass cannons, siege machines to swarm control. Seasonal and Arena-based unlocks add a sense of reward and discovery as players climb ranks. The system balances grind and reward by mixing predictable progression with occasional high-value drops and seasonal cosmetics, maintaining engagement without forcing pay-to-win outcomes. As your card pool grows, so does the depth of strategic options during matches, enabling more complex play patterns and richer decisionmaking. In short, the Card Collection is both the engine of personal growth and the palette for strategic expression in Clash Royale, rewarding dedication, planning, and thoughtful resource allocation.
  • Rarity and upgrades:Common to Legendary tiers dictate acquisition rates and upgrade costs that shape prioritization
  • Multiple acquisition paths:Chests, shop, season rewards, and clan donations offer varied ways to obtain cards
  • Resource management:Gold and fragments must be allocated strategically to maximize competitive power
  • Synergy and experimentation:New cards create fresh combos and encourage creative deckbuilding and meta shifts

# Clan Wars

Clan Wars adds a cooperative competitive layer to Clash Royale by letting players join forces, strategize together, and compete against other clans for significant rewards. In Clan Wars, members contribute by collecting cards, sharing decks, and coordinating attacks during scheduled war events. The format emphasizes team coordination because clan performance depends on the combined efforts of multiple members, not just individual skill. Players participate in multiple stages, from collecting war chests and forging plans to battling in showdown rounds and contributing to clan-wide rewards. Winning clan battles yields valuable resources such as epic and legendary cards, gold, and other progression materials, which accelerates the collective growth of the clan. The structure encourages internal communication: clans that discuss deck choices, scouting information, and match tactics generally perform better. Clan Wars also offers strategic depth through roles and specialization; some members focus on defense and collection while others optimize offensive runs. As clans progress through leagues, they face increasingly skilled opponents, necessitating better planning and tighter execution. This fosters a social environment where learning is shared—experienced players mentor newer members, donation strategies are refined, and meta-aware decisions are adopted communally. Seasonal rotations and events keep the Clan Wars experience fresh, giving clans reasons to adapt and improve together. Ultimately, Clan Wars transforms individual card battles into a shared pursuit of glory, turning daily play into a collaborative endeavor that rewards coordination, strategy, and long-term commitment.
  • Team coordination:Clan success depends on shared plans, deck choices, and coordinated participation
  • Collective rewards:War victories grant valuable cards, gold, and progression materials for the whole clan
  • Specialization and roles:Members can focus on different tasks like collection, defense, or attack optimization
  • Community growth:Clan Wars encourages mentoring, strategic discussion, and cooperative meta development

# Seasonal Events

Seasonal Events in Clash Royale introduce limited-time content, themed challenges, and unique rewards that refresh the gameplay experience regularly. Each season typically brings a new Season Pass, special challenges, and cosmetic items like tower skins and emotes, which provide incentives beyond standard progression. Seasonal mechanics often experiment with alternate rules, special arenas, or unique card interactions that invite players to adapt and test new strategies without committing to permanent meta shifts. These events create a sense of urgency and excitement by offering time-limited goals and rewards, encouraging players to engage more frequently and to explore cards or playstyles they might not otherwise use. The Season Pass itself delivers a curated track of rewards that reward both casual and dedicated players, offering free and premium tiers for different levels of engagement. Additionally, seasonal tournaments and balance changes often coincide with events, shaping the competitive landscape and giving rise to new trends as players react to updated card abilities. Seasonal Event challenges vary in complexity, from quick, casual skirmishes to high-stakes trials that require refined skill, making the offerings appealing to a wide skill range. The rotating nature of seasons keeps the game feeling alive, motivating players to return regularly to claim rewards, try fresh content, and measure themselves in new formats. For creators and community organizers, seasons are an opportunity to spotlight competitive stories, share highlight plays, and unify the player base around shared experiences that punctuate the ongoing lifecycle of the game.
  • Time limited incentives:Seasonal rewards and challenges create urgency and encourage regular play
  • Season Pass rewards:Curated reward tracks offer both free and premium progression benefits
  • Experimental modes:Limited rules and arenas let players try new strategies without permanent meta changes
  • Community engagement:Seasons provide shared narratives and events that bring players together and spotlight creativity

# What're users talking about Clash Royale Mod APK

Download HappyMod to join real time talk with millions of users.

  • User reviews
  • User requests

Write a review for Clash Royale Mod APK

Rate it:

Average rating out of 647

3.6
Submit a review

User reviews (647)

Z

@Anonymous   2025-12-07 20:21:08

From:ZA   Device:SM-A315F   OS:android 12
whenever I try to play it takes me out of the game

G

@Anonymous   2025-12-06 03:36:11

From:GB   Device:SM-A145R   OS:android 14
it's really fun but I do wish I know it would be unfair but you could play against normal people

I

@Anonymous   2025-12-05 23:24:17

From:IN   Device:I2221   OS:android 15
stuck on loading, shows 75%and updating

I

@Anonymous   2025-12-05 21:03:41

From:IN   Device:CPH2753   OS:android 15
stuck on loading screen

S

@Anonymous   2025-12-02 06:55:38

From:SY   Device:Infinix X6525   OS:android 13
good and it's work, so thank you for this game

I

@Anonymous   2025-12-01 19:27:58

From:IL   Device:SM-A356E   OS:android 16
good ? and good luck for your day

I

@Anonymous   2025-12-01 14:26:26

From:IN   Device:SM-S938B   OS:android 16
not working stuck at updating screen

E

@Anonymous   2025-11-28 10:06:20

From:EG   Device:SM-M225FV   OS:android 13
hi to me and my family and friends of the victims of the

W

@Anonymous   2025-11-26 11:19:28

From:WS   Device:SM-S908E   OS:android 15
this mod is good and I GOT MEGA KNIGHT!!!

Z

@Anonymous   2025-11-25 23:36:59

From:ZA   Device:MGA-LX9   OS:android 10
Great game, just needs to be updated faster

U

@Anonymous   2025-11-23 10:46:23

From:US   Device:KFQUWI   OS:android 11
the problem is that the game will not work

S

@Anonymous   2025-11-19 06:04:17

From:SI   Device:SM-A266B   OS:android 16
this is the best game

T

@Anonymous   2025-11-17 07:24:03

From:TN   Device:23021RAAEG   OS:android 15
very good modded clash royale

Z

@Anonymous   2025-11-17 02:58:16

From:ZA   Device:CRT-NX1   OS:android 15
Very nice helps you train

U

@Anonymous   2025-11-17 01:43:09

From:US   Device:moto g 5G - 2024   OS:android 15
the game isn't the real clash Royale

U

@Anonymous   2025-11-14 22:15:40

From:US   Device:SM-S911U   OS:android 16
pretty good for a game

I

@Anonymous   2025-11-12 23:48:23

From:IN   Device:2311DRN14I   OS:android 15
kindly fix it. It was just stuck in the loading screen

J

@Anonymous   2025-11-10 19:04:09

From:JO   Device:Infinix X6532C   OS:android 14
stuck on updating i cant play or do anything

G

@Anonymous   2025-11-10 05:41:57

From:GB   Device:T433D   OS:android 14
did anyone see the 67

C

@Anonymous   2025-11-09 03:32:10

From:CA   Device:SM-S911W   OS:android 15
amazing mode i had fun playin??

More...[+]

Request a latest version of Clash Royale Mod

If this mod doesn't work, you can send a request to HappyMod community. Users will upload a new mod if they've one.
Send a request

Latest requests related to Clash Royale

M

@Anonymous   2023-03-28 13:05:52

From:MX   Device:motorola moto e6 play   OS:android 9
Todo ilimitado y todas las cartas desbloqueadas al máximo y subir de arena super fácil

U

@Anonymous   2023-03-23 10:51:37

From:US   Device:samsung SM-J701M   OS:android 9
amammasmmamsmsmsmkskdkdkdkdkdkdldlldldldlakakkskskdkdkkdkdkdkdkdkdkdkdkkdkkkkkkkdkdntjytggggbyhknfhctvfb hlskakskskskslskslalallakslalalalallalalalalallalalalallalalalalallalalalalallalalalalalallalalalalallqlslalalalamallalalalalalallalapwpapppornoamamammamakakakkakakakakakakakkakaiakaikaial pormo aiakaiaiiajskskskskk

U

@Anonymous   2023-03-21 21:31:37

From:US   Device:OPPO CPH2285   OS:android 12
update this app as soon as it's possible or tell us how to update

E

@Anonymous   2023-03-18 06:10:21

From:ES   Device:samsung SM-A105M   OS:android 9
El juego es el mejor megusto mucho iejwhwkkwkwkskskskskskskskskkskksksksksksksksksjeieneveoqlnabsbaoanwbwiwjevebeowjwbekwowkabwbeuwikwnwbwhw8wibwbe8wjwjwkwkwkskkskdhdeueiekebejq8i282u3u3738299qoqnsnsbsiiakabsjsilaksjsusikwkevei3i2991uwyqksosjkeks

U

@Anonymous   2023-03-17 22:00:23

From:US   Device:HUAWEI PPA-LX2   OS:android 10
Hey we need a newer version of clash royale please update the mod

B

@Anonymous   2023-03-16 07:06:05

From:BR   Device:samsung SM-A107M   OS:android 11
queira muito esse mo queria melhor ele e o modfica ele

I

@Anonymous   2023-03-16 00:57:47

From:IT   Device:TCL 6102H   OS:android 12
io vorrei una mod che ti dia disponibilità finanziarie ilimitata

S

@Anonymous   2023-03-15 19:31:57

From:SA   Device:samsung SM-A125F   OS:android 12
in update ٠٠٠٠٠٠٠٠٠٠٠٠٠٠٠٠٠٠٠٠٠٠٠٠٠...................

U

@Anonymous   2023-03-15 07:06:48

From:US   Device:TECNO MOBILE LIMITED TECNO KG8   OS:android 11
quiero la versión más actualizada del juego porfavor... no sean malos y compaltan compaltan ...

M

@Anonymous   2023-03-14 19:25:04

From:MY   Device:realme RMX2195   OS:android 11
update please...this apk not update...cannot play because this game not update...please update right now...i want play clash royale mod apk...

S

@Anonymous   2023-03-11 22:51:45

From:SK   Device:HUAWEI ATU-L31   OS:android 8.0.0
9999999999999999999 nich 9999999999999999999 drahokamov a všetky postavy zdarma a všetky postavy sú vylepšené na max

M

@Anonymous   2023-03-06 07:48:23

From:MX   Device:TCL 8092   OS:android 10
dinero infinito sin actualizar por qué no me deja jugar

P

@Anonymous   2023-03-06 02:15:08

From:PT   Device:samsung SM-A326B   OS:android 13
999.999.999 coins 999.999.999 gems. bots vs players and victory fast

E

@Anonymous   2023-03-04 15:00:22

From:EG   Device:Xiaomi Mi A2   OS:android 10
jgghhhxjcyshcdjzuabcsuzbuvsjdyiahsixhkavdixhskdgsixhishxisshsi

B

@Anonymous   2023-03-03 08:56:18

From:BR   Device:samsung SM-G532M   OS:android 6.0.1
quero jogar Clash Royale modelo muito obrigado portador

U

@Anonymous   2023-03-01 16:56:46

From:US   Device:OPPO OPPO R7   OS:android 5.1
please I would like to request mod APK for TikFollowers and Unfollowers

P

@Anonymous   2023-03-01 05:07:38

From:PL   Device:Xiaomi M2003J15SC   OS:android 11
polski mod nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn

J

@Anonymous   2023-02-26 13:54:53

From:JP   Device:Ulefone Note 6P   OS:android 11
無限のクリスタル、無限の金、無限モードこのゲームは、楽しいです、クラッシュロワイヤルは、クリスタルを集めて基地を作るゲームです!!!

I

@Anonymous   2023-02-19 21:25:08

From:IT   Device:samsung SM-A135F   OS:android 13
vorrei una mod che vada sul mio dispositivo e che per installarla non mi costringa a disintallare clash royale originale

U

@Anonymous   2023-02-16 03:09:26

From:UY   Device:samsung SM-A235M   OS:android 13
solo quiero q actualicen el clash royal q tiene gemas y dinero infinito, pero solo con las cartas oficiales de clash royale

More...[+]

Logo

HappyMod

Best mod downloader
for 100% working mods.

Clash Royale Mod apk ~ download faster with HappyMod.

Other Versions

Found (47) versions of Clash Royale Mod

Clash Royale Mod Apk [Unlimited money]

Clash Royale Mod Apk [Unlimited money]

Unlimited Crystals
Unlimited Coins
Private Serve
Clash Royale Mod Apk [Unlimited money]

Clash Royale Mod Apk [Unlimited money]

Unlimited Crystals
Unlimited Coins
Private Serve
Clash Royale Mod Apk [Unlimited money]

Clash Royale Mod Apk [Unlimited money]

Unlimited Crystals
Unlimited Coins
Private Serve
Clash Royale Mod Apk [Unlimited money]

Clash Royale Mod Apk [Unlimited money]

Unlimited Crystals
Unlimited Coins
Private Server
Mod Menu

Clash Royale Mod Apk [Unlimited money]

Unlimited Crystals
Unlimited Coins
Private Server

Clash Royale Mod Apk [Unlimited money]

Unlimited Crystals
Unlimited Coins
Private Server

Clash Royale Mod Apk [Unlimited money]

Unlimited Crystals
Unlimited Coins
Private Server

Clash Royale Mod Apk [Unlimited money]

Unlimited Coins + Unlimited Gems
Mod Menu

Clash Royale Mod Apk [Unlimited money]

Unlimited Coins + Unlimited Gems
Mod Menu

Clash Royale Mod Apk [Unlimited money]

null's royale gold and infinity gems
Mod Menu

Clash Royale Mod Apk [Unlimited money]

Unlimited Money, Unlimited Gems 3.2728.0
Mod Menu

More...[+]

Other Apps from this developer

Explore more great apps from the same developer...

Brawl Stars Mod Apk 64.226 [Unlimited money]

Brawl Stars Mod Apk 64.226 [Unlimited money]

Unlimited money, ammo, antikick
Private Serve
Clash of Clans Mod Apk 18.0.2 [Unlimited money]

Clash of Clans Mod Apk 18.0.2 [Unlimited money]

Unlimited Gold
Unlimited Gems
Unlimited Oils
Unlimited Elixir
Private Serve
Clash Royale Mod Apk 12.169.3 [Unlimited money]

Clash Royale Mod Apk 12.169.3 [Unlimited money]

Unlimited Crystals
Unlimited Coins
Private Serve
Clash Mini Mod Apk 1.2592.3 [Unlocked]

Clash Mini Mod Apk 1.2592.3 [Unlocked]

Complete Quests to Collect Minis and Unlock New Abilities
Rush Wars Mod Apk 0.64 [Unlocked]

Rush Wars Mod Apk 0.64 [Unlocked]

Unlocked
removed country restrictions
Clash Quest Mod Apk 0.441.143

Clash Quest Mod Apk 0.441.143

Latest Version Download