The Wolf: Animal Game MMORPG Mod

The Wolf: Animal Game MMORPG Mod APK 4.3.1 [Free purchase][Free shopping]

100% working

Trusted   Update on: 2025-12-22

  • Video preview
  • The Wolf: Animal Game MMORPG screenshots
  • The Wolf: Animal Game MMORPG screenshots
  • The Wolf: Animal Game MMORPG screenshots
App nameThe Wolf: Animal Game MMORPG Mod APK 4.3.1 [Free purchase][Free shopping]
Version4.3.1
Update on2025-12-22
Size101.55 MB
Price Free
Rating 5.0
SystemAndroid 6.0 (M)
Mod info Free purchase; Free shopping
Developer
Category Roleplaying
Get it on Google Play
Download original apk
Share
Download Links:

The Wolf: Animal Game MMORPG Mod APK 4.3.1 [Free purchase][Free shopping]

Use HappyMod App to get faster download!
You can still download from this domain (happymod.to) for now, but we strongly recommend switching to our new official domain for future updates and support: Download The Wolf: Animal Game MMORPG at HappyMod.net.
* All mod apks are uploaded by users. If there is any infringement, please contact us to remove it.

# Mod Info

The main advantages / modifications of The Wolf: Animal Game MMORPG Mod APK 4.3.1 [Free purchase][Free shopping]

Video Verified

Mod V1 features:
MOD, Free Shopping

Mod V2 features:
MOD: Free Shopping
Mod Menu

Mod V3 features:
Unlimited money

# To understand the wolf, you must first comprehend its mind.

Your character's wolf persona comes with many surprises. Not only will you understand what they think and see what they do, but you'll end up developing a deep respect for them. You can rely on The Wolf to help you navigate the wild wolf's antics. In the new game, you have the option of choosing your wolf. There are many colors to pick from, including gray wolves and brown wolves. You can even pick a black wolf if you'd like. Choosing your wolf is an important part of playing the game because it determines the type of wolf that you play. As you continue the series, you'll be able to explore the wild world on your own. You'll also live in a herd with other wolves. This will be an odd experience, but one that will become familiar over time.

# Become the first wolf.

Wolf characters develop from naturally good surroundings. The Wolf inspires compelling stories with every appearance. It's imperative to leverage the Wolf's strengths to lead the pack. That’s why we want to rise to the top as the alpha wolf. Aspiring to lead our peers provides motivation that drives us toward success. As the Alpha, my wolves and I face many challengers. Testing my intelligence and tactical savvy proves essential in this contest. Likewise, maintaining friendly relations with other packs demands my focus. When I’ve established myself as the leader, I can prioritize my strength while also fostering close ties with other groups.

# Acquire knowledge on how to create an artistic defense of beauty.

As the leader of the wolf pack, you always keep your head held high. If another wolf encroaches on your territory, you should pursue him with determination. Doing so will establish your territory as legitimate defense and will not be detrimental to any wolves in our pack under our control. Not only will The Wolf challenge you, it will also grant you new perks once you conquer it. Each subsequent event you participate in will take your role to a higher tier. Additionally, the game will feature new environments and changing schools that force you to evolve as a hunter. The Wolf challenges players to grow up every day through its interesting environment, 3D graphics and agile gameplay. This game always resonates with players because of its deep storyline, social aspects and long-term effect on their lives. Getting through difficult circumstances instills courage and also gives us new challenges to overcome.

# Each KEY FEATURE has a unique identifying characteristic.

Every corner of the earth is filled with rival contenders! Wolves must confront each other in real time to conquer the forest. You can begin playing the game by creating a group with your family and friends. You can easily communicate with your group via the chat features and friend list. Can you best the strength of a Gray Wolf with your might? Or is it Dhole Wolves that you confront? Perhaps a mysterious Black Wolf has the most similar appearance to you? Select your favorite and create a unique persona based on that choice! You have total control over your fate as the Alpha of the pack! This simulator doesn’t force you to follow a specific path by creating traits and abilities to improve. Instead, you’re in charge of your destiny by deciding which traits and abilities to enhance. Experience the stunning high-end visuals throughout the game, from the mountain streams to the cave you explore. This makes the experience of exploring the map truly enjoyable. The creatures seem so real when you try to catch them all! In hunting mode, you can see through the landscape while searching for prey such as racoons, rabbits, squirrels and foxes. You can also hunt bisons, bulls and racoons in open fields. Additionally, you can track down rabbits, deer and bisons in the wild. When facing a tough foe, work with other gamers to defeat the most challenging enemies. The Battle Arena setting offers even more intense combat when you team up with other wolves against another pack. This is a fiercely competitive environment!

# About The Wolf

The Stark family knows how to stick together, with a unified family that always helps and assists others. Wolf is the family’s symbol, as Ned Stark once said: when winter snows fall and fierce winds blow, the lone wolf dies but the pack carries on. Wolves have long been worshipped in both culture and religion. They are an animal that represents both good and bad sides of strength, perseverance, solidarity and success. I wondered what it would be like to live the life of a wolf through reading The call of the Wild, a novel written by Jack London. I imagine this to be a living free of human influence. The Wolf helped me understand the questions I had about work and everyday life. Thanks to him, I don’t have to stress about my responsibilities anymore.

# What is The Wolf?

Featured on the Swift Apps lineup of multi-player games, The Wolf places a focus on wolf characters instead of traditional warrior or witch roles. The game encourages players to work together and strategically build their wolves' stats. As a wolf on the move, you must find food, water and protection. Alternatively, you can hunt other wolves or battle them for turf.

# Gameplay

There is no plot in this game; all you're tasked with is survival in the steppe with a wolf at your side. With wolves typically following a pack, this game takes place entirely by yourself. You are a wolf with insatiable bloodlust and instinct. Embrace nature's power by running fast and snarling with your teeth exposed. Although buffalo floods are an excellent prey option, you have to follow the flock to succesfully hunt them. You should also be careful when hunting because the forest is full of other animals. You can meet wolves in food chains such as tigers and lions. Additionally, you can encounter sheep, rabbits, deer and other animals.

# Upgrade your wolf to a more powerful creature.

You can alter wolf stats such as Health, Attack, Defense and Speed. Adjusting these values after hunting and killing a creature grants you experience, which allows you to upgrade your chosen wolf attributes. ———

# The Wolf: Animal Game MMORPG Mod APK 4.3.1 [Free purchase][Free shopping] Features:



The Wolf Mod game is a popular simulation game which you should dive into the world of wild wolves and live your life as one of them. In this mod, you can free to use coins and gems to upgrade attributes and skills. This will make the wolf you play is much stronger than others. So, this game will be easy for you.

Sign in social account: Not supported

Game online or offline: Online

Root Needed?: No

License Needed?: No

Install Steps:
1) Download APK files on happymod.to.
2.) Install and Enjoy.

Also read: COC MOD. Mod info: unlimted money and unlimited coins, private server.



Dive into the world of wild wolves and live your life as one of them! The wolf RPG on mobile is finally here. Explore the amazing environment, develop your character and upgrade your skills to become the Alpha of your pack! You can try your strength in one of two modes: CO-OP or PVP - everything in Online Real-Time Multiplayer. Play with people from all over the World!

ONLINE MULTIPLAYER SIMULATOR

Compete with players from all around the World! The wilderness is never empty. Meet other wolves in real time and conquer the forest!

PLAY WITH FRIENDS

Join your friends and family in game! You can now easily create your own team and play together. Keeping in touch is easy thanks to the friends list and chat options.

CHARACTER CUSTOMIZATION

Are you a mighty Gray Wolf? A Dhole Wolf? Or maybe a mysterious Black Wolf resembles you the most? Choose your favorite and create your unique character!

RPG SYSTEM

You are the king of your own destiny! There is no imposed path to follow in this simulator. Decide which attributes to develop and which skills to upgrade to become the Alpha of the pack!

REALISTIC 3D GRAPHICS

Enjoy the stroll around the map and admire the stunning environment! Starting from your den all the way to the mountains and streams, the high-end graphics make the game incredibly pleasant. Don't the animals look realistic? Try and chase them all!

VARIOUS GAME MODES

Hunting mode lets you explore the map while searching for prey: from rats and rabbits, through does, foxes and racoons, all the way to bisons and bulls. Cooperate with other players to fight the strongest opponents! If you need a bigger thrill, join the Battle Arena mode - you will be teamed up with other wolves to compete with another pack. This means war!

To understand the wolf, you must first comprehend its mind.
Become the first wolf.
Acquire knowledge on how to create an artistic defense of beauty.
Each KEY FEATURE has a unique identifying characteristic.
About The Wolf
What is The Wolf?
Gameplay
Upgrade your wolf to a more powerful creature.

# How to download and install The Wolf: Animal Game MMORPG Mod APK 4.3.1 [Free purchase][Free shopping]?

// Option A //

To download The Wolf: Animal Game MMORPG mod from HappyMod.to.
You need enable the option "Unknown Sources".
1. Click on the above link to download The Wolf: Animal Game MMORPG mod APK.
2. Save the file in your device Downloads folder.
3. Now tap on Install and wait for the installation to finish.
4. Once it is done, open the game and start playing it right away.

// Option B //

To download The Wolf: Animal Game MMORPG from HappyMod APP, you can follow this:
1. Open your browser and download the HappyMod APK file from HappyMod.to - the only official website of HappyMod.
2. Open Android Settings and go into Privacy or Security.
3. Tap the option to Allow Unknown Sources and enable it.
4. Go to your Android downloads and tap the APK file.
5. Follow the directions on the screen to install it.
6. Search The Wolf: Animal Game MMORPG in HappyMod App.

# Full Specifications of The Wolf: Animal Game MMORPG Mod APK 4.3.1 [Free purchase][Free shopping]

// Download Information //

Size101.5MB
Version4.3.1
Version Code200232
Langaf am ar as az be bg bn bs ca cs da de el en-AU en-CA en-GB en-IN en-XC es es-US et eu fa fi fr fr-CA gl gu hi hr hu hy in is it iw ja ka kk km kn ko ky lo lt lv mk ml mn mr ms my nb ne nl or pa pl pt pt-BR pt-PT ro ru si sk sl sq sr sr-Latn sv sw ta te th tl tr uk ur uz vi zh-CN zh-HK zh-TW zu

More...[+]

// Operation Systems //

PermissionACCESS_NETWORK_STATE BILLING RECEIVE CHECK_LICENSE INTERNET ACCESS_NETWORK_STATE WAKE_LOCK VIBRATE GET_TASKS ACCESS_WIFI_STATE C2D_MESSAGE AD_ID BIND_GET_INSTALL_REFERRER_SERVICE ACCESS_ADSERVICES_ATTRIBUTION READ_APP_INFO GET_COMMON_DATA POST_NOTIFICATIONS ACCESS_ADSERVICES_AD_ID DYNAMIC_RECEIVER_NOT_EXPORTED_PERMISSION
Permission Text OTHER:
OTHER:
Allows applications to access information about networks.
Allows applications to open network sockets.
Allows applications to access information about networks.
Allows using PowerManager WakeLocks to keep processor from sleeping or screen from dimming.
Allows access to the vibrator.
This constant was deprecated in API level 21. No longer enforced.
Allows applications to access information about Wi-Fi networks.
Min Sdk23
Min Sdk TxtAndroid 6.0 (M)
Target Sdk35
Target Sdk Txt35
Multi WindowNo
Supports Screenssmall, normal, large, xlarge
CPUarmeabi-v7a
Open GL Int0
Supports Any DensityYes
Densities120, 160, 240, 320, 480, 640, 65534

// User Features //

Uses Feature Wi-Fi hardware features:
The app uses 802.11 networking (Wi-Fi) features on the device.
Uses Feature Touchscreen hardware features:
The app uses the Global System for Mobile Communications (GSM) telephony radio system.
The app uses the device's basic two-point multitouch capabilities, such as for pinch gestures, but the app does not need to track touches independently. This is a superset of the android.hardware.touchscreen feature.
The app uses the device's advanced multitouch capabilities for tracking two or more points independently. This feature is a superset of the android.hardware.touchscreen.multitouch feature.
Uses Feature The app uses 802.11 networking (Wi-Fi) features on the device.#:

// Signature //

Md53DFE068920894FED7724A2CB4C5B77DF
Signature8425E4149EB86567F99E1968C0E4CD9A34DCE795
Sha256E0663DAA0FC0A829E4B765A4C74C6789D05C8E7FF0D7226FA2F76A117B1E3FD1
Valid FromTue Aug 12 09:48:56 CEST 2025 until: Sat Dec 28 08:48:56 CET 2052
Serial Numberaf4cc971db8a93a1

// Developer //

Developerusa
OUu
OrganizationO
Localemsk
Countryusa
Citystr

# The Wolf: Animal Game MMORPG FAQ


Why can't I buy wolves in the game?


The current version of the mod does not support purchasing wolves, which is a common request among players.

This limitation may be due to the mod's design or coding restrictions. Developers often prioritize certain features, and purchasing wolves might not have been implemented yet.



How can I get infinite moons in the game?


To achieve infinite moons, you may need to adjust specific settings in the mod or look for an updated version that includes this feature.

Infinite moons can enhance gameplay significantly, allowing for more strategic moves. Check the mod's settings or community forums for potential updates or tweaks.



What should I do if the mod isn't functioning properly?


If the mod isn't working, try restarting the game or checking for any updates that might fix the issue.

Sometimes, mods can experience glitches or conflicts with the game. Restarting can refresh the game state, and updates may resolve compatibility issues.

Steps to resolve:
1. Close the game completely.
2. Restart your device.
3. Open the game again.
4. Check if the mod features are functioning.



Why does the feature not work in the game?


Certain features may not work due to compatibility issues or bugs within the mod.

Features can fail to operate for various reasons, including coding errors or conflicts with the game version. It's essential to keep an eye on updates from the mod developers.



Is there a way to fix the level cap issue?


If you're facing a level cap issue, consider checking if there are any settings in the mod that allow for level adjustments.

Level caps can be frustrating, especially if you want to progress further. Some mods have hidden settings that can be adjusted to bypass these limits.

Steps to resolve:
1. Open the mod settings menu.
2. Look for options related to leveling or experience.
3. Adjust the settings to increase your level cap.
4. Save changes and restart the game.

# What're users talking about The Wolf: Animal Game MMORPG Mod APK

Download HappyMod to join real time talk with millions of users.

  • User reviews
  • User requests

Write a review for The Wolf: Animal Game MMORPG Mod APK

Rate it:

Average rating out of 40

5.0
Submit a review

User reviews (40)

P

@Anonymous   2025-12-23 21:42:25

From:PH   Device:SM-T225   OS:android 12
yoo this is fire but I have a problem that when I tried to unlock the skins they just don't work pls fix this bug

C

@Anonymous   2025-12-20 21:33:12

From:CZ   Device:2201117TY   OS:android 13
Unfortunately, when opening the game, I keep receiving a pop-up telling me to download the latest version. So I am obligated to say that it's not working.

U

@Anonymous   2025-12-20 03:59:08

From:US   Device:T779W   OS:android 12
it says it needs an update won't let me play it

Z

@Anonymous   2025-12-04 20:31:16

From:ZA   Device:SM-A235F   OS:android 14
It has good graphics , looks very realistic and I love Animal game's ❤️

I

@Anonymous   2025-11-23 13:06:10

From:IN   Device:V2432   OS:android 15
this game is very good I'm rate this game for 80%those are animal friends

U

@Anonymous   2025-11-16 09:59:30

From:US   Device:Pixel 9a   OS:android 16
it doesn't work on new Google pixel devices

I

@Anonymous   2025-11-11 13:59:22

From:IN   Device:SM-A037F   OS:android 13
not a bad its working ? but not completed mod

J

@Anonymous   2025-11-10 11:39:43

From:JM   Device:SM-A356U   OS:android 16
its a good game, but the part where you have to spend real money for some of the Items need go because free

M

@Anonymous   2025-11-08 11:57:23

From:MO   Device:SM-A1660   OS:android 16
some in game purchasable items can't be purchased like the wolf skins. which was the point of me struggling to get this mod because my dad got mad at me when he found out. it was my childhood dream, will you fulfill it? your make a fan or 2 or thousands, please?

U

@Anonymous   2025-10-26 14:12:04

From:US   Device:moto g 5G - 2024   OS:android 15
its good i want to keep it

U

@Anonymous   2025-10-08 02:24:16

From:US   Device:TB328FU   OS:android 12
cool, this is so cool

I

@Anonymous   2025-09-27 00:11:35

From:IN   Device:CPH2667   OS:android 15
not money unlimited but good game to play

I

@Anonymous   2025-09-18 11:41:17

From:IN   Device:CPH2617   OS:android 15
it's wrong game, I don't receive unlimited coin in this game

A

@Anonymous   2025-08-28 15:29:18

From:AU   Device:M2006C3LG   OS:android 10
Yes it works successfully and for the creator can you also make mode for block man go (unlimited Gcubes/money)

I

@Anonymous   2025-08-28 02:03:51

From:IN   Device:Redmi Note 9 Pro   OS:android 12
it is extremely good

M

@Anonymous   2025-08-28 01:56:57

From:MY   Device:Infinix X6838   OS:android 14
need to update the game

U

@Anonymous   2025-08-04 06:58:03

From:US   Device:moto g power (2022)   OS:android 12
everything is not unlimited

Z

@Anonymous   2025-07-24 01:58:49

From:ZA   Device:SM-A315F   OS:android 12
I I want to give me the map one map is supposed to be unlocked but it isn't

U

@Anonymous   2025-07-16 02:10:32

From:US   Device:moto g 5G - 2023   OS:android 14
I want to create or join a pack but it never loads screen

U

@Anonymous   2025-07-04 19:52:42

From:UZ   Device:Redmi Note 8   OS:android 11
zor yaxshi realistik

More...[+]

Request a latest version of The Wolf: Animal Game MMORPG Mod

If this mod doesn't work, you can send a request to HappyMod community. Users will upload a new mod if they've one.
Send a request

Latest requests related to The Wolf: Animal Game MMORPG

R

@Anonymous   2023-03-26 21:23:49

From:RU   Device:HUAWEI DBY-W09   OS:android 10
Почему когда я что-то покупаю у меня происходит вот это?

U

@Anonymous   2023-03-22 06:39:54

From:US   Device:Amazon KFDOWI   OS:android 5.1.1
Hoi Guys please infinity HP please we totally need it please

C

@Anonymous   2023-03-19 14:24:55

From:CN   Device:samsung SM-F926B   OS:android 13
porfavor

B

@Anonymous   2023-03-19 05:53:23

From:BR   Device:motorola moto g(6) play   OS:android 9
adicionar a nova versão com dinheiro infinito, compras gratis, skins desbloqueadas, muitos diamantes, habilidades

U

@Anonymous   2023-03-14 09:58:28

From:US   Device:vivo vivo 1818   OS:android 11
please upload the latest version of wolf make it fast

U

@Anonymous   2023-03-13 15:48:57

From:US   Device:itel itel W5001P   OS:android 8.1.0
There's a new update...Pls we need the new Modded version Tysmღ

M

@Anonymous   2023-03-10 08:12:22

From:MX   Device:HUAWEI AGS3K-W09   OS:android 10
Please Uodate to the NEW version Please XD

B

@Anonymous   2023-03-08 20:58:52

From:BE   Device:samsung SM-A137F   OS:android 13
need the wolf mod 2.90 pleas give use the mod i well really appreciate it

A

@Anonymous   2023-02-28 03:43:32

From:AE   Device:samsung SM-A235F   OS:android 13
قطرات بدون توقيت 0,000000000,000000,00002282>÷=

I

@Anonymous   2023-02-21 12:11:47

From:IN   Device:vivo V2037   OS:android 12
100000000000000000000000000000000000000000000000000

U

@Anonymous   2023-02-20 02:12:54

From:US   Device:Safaricom NEON RAY 2   OS:android 10
in this game iwant it to be an offline mode so i can play the games offline or online when I want

P

@Anonymous   2023-02-11 14:02:25

From:PL   Device:Xiaomi M2003J15SC   OS:android 10
Unlimited money and diamonds free vip, skins wolf and unlimited attack

H

@Anonymous   2023-01-30 01:20:00

From:HU   Device:samsung SM-A226B   OS:android 13
hp go up to 900k attack goes to 900k+ defence and speed too all power up to skill boost all wolf lvl 99

B

@Anonymous   2023-01-21 04:00:52

From:BR   Device:samsung SM-A135M   OS:android 12
eu quero jogar com o mode no skill cooldown para se divertir com meus amigos o mod pode pelo menos durar até a próxima atualização

B

@Anonymous   2023-01-16 22:08:49

From:BR   Device:samsung SM-A315G   OS:android 12
please someone bring a mod whit infinite resources and max level.

U

@Anonymous   2022-12-24 23:19:00

From:US   Device:samsung SM-A136U   OS:android 12
Update this plz the game has new skin in the game and update

B

@Anonymous   2022-12-23 23:14:37

From:BR   Device:motorola moto e20   OS:android 11
compra grátis. tudo de graça. vida no máximo vip grátis

A

@Anonymous   2022-12-13 14:28:33

From:AE   Device:samsung SM-N950F   OS:android 9
لقد قمت بتنزيل 4 مودات ولم يعمل احدهم كما هو موضح في الصور ارجو العمل على مود ثاني وشكرا

U

@Anonymous   2022-12-09 04:50:26

From:US   Device:samsung SM-J810M   OS:android 10
Mod Habilidades infinitas.dddsssgeeenrsszjamdMNNNNNNNummmmmmmmmmmmmdMDDDHHHHMHHHMMMMDDDMAJRRRHHHHHHHHHHHHHHHHHHHHKKKUKKKKAAAAYKKYSSSSSSSSRRRRRAMHHHRRRRARRRKKKKWWWWWQNNNNRAAAAKKKKKKKKKKLKKKAAAAALRRRRRR

K

@Anonymous   2022-10-31 12:58:10

From:KH   Device:Xiaomi M2006C3LG   OS:android 10
100000000000000000000000000000000000000000 Cute asd

More...[+]

Logo

HappyMod

Best mod downloader
for 100% working mods.

The Wolf: Animal Game MMORPG Mod apk ~ download faster with HappyMod.

Other Versions

Found (82) versions of The Wolf: Animal Game MMORPG Mod

More...[+]

Related Mods

People who download The Wolf: Animal Game MMORPG Mod also like...

WWE Tap Mania: Get in the Ring in this Idle Tapper Mod Apk

WWE Tap Mania: Get in the Ring in this Idle Tapper Mod Apk

– Debug Menu Enabled – Access it in Settings
+ Grant Gold
+ Grant Prestige
+ Grant some perks
+ Grant any shards – you can chose them
+ Stage Teleport
+ More…
IBM Micromedex Pediatrics Mod Apk [Subscribed]

IBM Micromedex Pediatrics Mod Apk [Subscribed]

Subscribed
● No registration/password needed
Alien Creeps TD Mod Apk [Unlimited money]

Alien Creeps TD Mod Apk [Unlimited money]

MOD, Unlimited Money
No Ads
Mod Menu
Hard Time Mod Apk [Free purchase][Unlocked][Full]

Hard Time Mod Apk [Free purchase][Unlocked][Full]

Unlock the US dollar purchase as the full version, no need to buy!
Pocketown Mod Apk [Mega mod]

Pocketown Mod Apk [Mega mod]

Mega Mod
1. enemy level 0
2. High move speed character+
NOTE :
1. Only work in Field and Elite4
2. You need Obb to play.
3. Move speed for faster clearing Quest

More...[+]

Other Apps from this developer

Explore more great apps from the same developer...