Vector Classic Mod

Vector Classic Mod APK 1.5.0

100% working

Trusted   Update on: 2025-12-08

  • Video preview
  • Vector Classic screenshots
  • Vector Classic screenshots
  • Vector Classic screenshots
App nameVector Classic Mod APK 1.5.0
Version1.5.0
Update on2025-12-08
Size127.13 MB
Price Free
Rating 5.0
SystemAndroid 6.0 (M)
Mod info
No Ads
Mod Menu
Developer
Category Arcade
Get it on Google Play
Download original apk
Share
Download Links:

Vector Classic Mod APK 1.5.0

Use HappyMod App to get faster download!
You can still download from this domain (happymod.to) for now, but we strongly recommend switching to our new official domain for future updates and support: Download Vector Classic at HappyMod.net.
* All mod apks are uploaded by users. If there is any infringement, please contact us to remove it.

# Mod Info

The main advantages / modifications of Vector Classic Mod APK 1.5.0

Video Verified


No Ads
Mod Menu

# Vector Classic Mod APK 1.5.0 Features:



Vector Full Mod Money is a popular mobile game developed by the well-known gaming company, Nekki. The game is an action parkour inspired platform where players play as a skilled runner, navigating through various environments in a dystopian world, trying to evade capture from a tyrannical government. The game offers various challenges, obstacles, and stunts that players must complete using a range of cool tricks.

Gameplay:

Vector Full Mod Money offers a riveting action-packed experience that will keep players hooked. Featuring an impressive 40 levels, the game is designed to keep players engaged for hours as they navigate through different environments, such as abandoned buildings, factories, and city rooftops. The game also offers an endless mode, where players can keep playing until they die, trying to beat their previous score.

The game controls are easy and intuitive, allowing players to master the game quickly. The player can jump, slide, dash, and climb, allowing them to perform various stunts and evade obstacles. The game also features a "Quick Play" mode where players can practice their skills, which comes in handy for those trying to perfect their stunts.

Graphics:

One of the things that stand out in Vector Full Mod Money is its stunning graphics. The game features a stylish and visually appealing art style, with sleek and futuristic character designs that are pleasing to the eye. The game also features beautiful and detailed environments that will transport players to a dystopian world.

Sound:

The game's soundtrack is also a standout feature. The music perfectly complements the game's action, providing an adrenaline-infused feel that immerses the player in the game. Sound effects are also on point, providing clarity and feedback on the player's actions.

Mod Money:

The mod money feature adds to the game's overall experience. With mod money, players can get access to unlimited money, allowing for more customization options, such as purchasing new abilities, outfits, and skins for their character. With this feature, the players will find the game much more enjoyable.

Conclusion:

In conclusion, Vector Full Mod Money is a thrilling and enjoyable game that offers a unique blend of parkour, action, and adventure. Featuring stunning graphics, excellent sound, and easy-to-learn controls, the game is a must-try for lovers of the action and adventure genres. The mod money feature adds even more value to the game, making it highly addictive and rewarding. Overall, Vector Full Mod Money is a game that offers an unforgettable gaming experience.



Parkour-inspired action game is now available! Vector lets you break free and run! Don't get caught!

Vector is an exciting, arcade-style game featuring you as the exceptional free runner who won't be held down by the system. The game opens with a view into a totalitarian world where freedom and individually is nothing more than a distant dream. But the heart of a freerunner is strong, and you soon break free. Run, vault, slide and climb using extraordinary techniques based on the urban ninja sport of Parkour all while being chased by “Big Brother” who's sole purpose is to capture you and bring you back.

Inspired by the practice and principles of Parkour, Vector's intuitive controls please players of all levels, and sophisticated level designs challenge the most demanding players with fast-paced timing puzzles as the traceur “flows” over the dystopian rooftops.

Game Features:
- Arcade gameplay from the makers of the Shadow Fight games
- Astoundingly lifelike Parkour-inspired moves made possible by Cascadeur animation tools
- 40+ challenging levels
- Quick to learn, challenging to master

# How to download and install Vector Classic Mod APK 1.5.0 ?

// Option A //

To download Vector Classic mod from HappyMod.to.
You need enable the option "Unknown Sources".
1. Click on the above link to download Vector Classic mod APK.
2. Save the file in your device Downloads folder.
3. Now tap on Install and wait for the installation to finish.
4. Once it is done, open the game and start playing it right away.

// Option B //

To download Vector Classic from HappyMod APP, you can follow this:
1. Open your browser and download the HappyMod APK file from HappyMod.to - the only official website of HappyMod.
2. Open Android Settings and go into Privacy or Security.
3. Tap the option to Allow Unknown Sources and enable it.
4. Go to your Android downloads and tap the APK file.
5. Follow the directions on the screen to install it.
6. Search Vector Classic in HappyMod App.

# Full Specifications of Vector Classic Mod APK 1.5.0

// Download Information //

Size127.1MB
Version1.5.0
Version Code5000131
Langaf am ar as az be bg bn bs ca cs da de el en en-AU en-CA en-GB en-IN en-XC es es-US et eu fa fi fr fr-CA gl gu hi hr hu hy in is it iw ja ka kk km kn ko ky lo lt lv mk ml mn mr ms my nb ne nl or pa pl pt pt-BR pt-PT ro ru si sk sl sq sr sr-Latn sv sw ta te th tl tr uk ur uz vi zh zh-CN zh-HK zh-MO zh-TW zu

More...[+]

// Operation Systems //

PermissionINTERNET ACCESS_NETWORK_STATE AD_ID VIBRATE BIND_GET_INSTALL_REFERRER_SERVICE BIND_APPHUB_SERVICE ACCESS_ADSERVICES_ATTRIBUTION WAKE_LOCK ACCESS_ADSERVICES_AD_ID POST_NOTIFICATIONS RECEIVE BILLING ACCESS_ADSERVICES_TOPICS FOREGROUND_SERVICE DYNAMIC_RECEIVER_NOT_EXPORTED_PERMISSION C2D_MESSAGE CHECK_LICENSE
Permission Text OTHER:
OTHER:
Allows applications to open network sockets.
Allows applications to access information about networks.
Allows access to the vibrator.
Allows using PowerManager WakeLocks to keep processor from sleeping or screen from dimming.
Min Sdk23
Min Sdk TxtAndroid 6.0 (M)
Target Sdk34
Target Sdk Txt34
Multi WindowNo
Supports Screenssmall, normal, large, xlarge
CPUarm64-v8a
Open GL Int0
Supports Any DensityYes
Densities120, 160, 240, 320, 480, 640, 65534

// User Features //

Uses Feature Touchscreen hardware features:
The app uses the Global System for Mobile Communications (GSM) telephony radio system.
The app uses the device's basic two-point multitouch capabilities, such as for pinch gestures, but the app does not need to track touches independently. This is a superset of the android.hardware.touchscreen feature.
The app uses the device's advanced multitouch capabilities for tracking two or more points independently. This feature is a superset of the android.hardware.touchscreen.multitouch feature.

// Signature //

Md57B24D024D501B6FB77B6AE095340E559
SignatureFCA3D6A27DD90DDF78FFD2F0E58591108120138B
Sha2562254EA6BA980BAF3D8C401B014517D0D3367E3BAAAF3F632E6DA37C26F4982E1
Valid FromTue Aug 12 09:50:01 CEST 2025 until: Sat Dec 28 08:50:01 CET 2052
Serial Numberc33701c02a6d2437

// Developer //

Developerusa
OUu
OrganizationO
Localemsk
Countryusa
Citystr

# Vector Classic FAQ


What are the main objectives in the game?


The main objectives vary by level but generally include completing tasks, collecting items, and overcoming challenges to progress through the game.



How can I earn unlimited money in the game?


To earn unlimited money, you can utilize specific in-game features or mods that allow for currency generation, enhancing your gameplay experience.

Using mods can provide unlimited resources, making it easier to purchase upgrades and items. However, be cautious as this may affect game balance.



Are there any special items or power-ups available?


Yes, the game features various special items and power-ups that can enhance your abilities or provide advantages during gameplay.

These items can be found throughout the game or earned by completing specific challenges. They can significantly improve your performance in difficult levels.



How do I unlock new levels or areas in the game?


New levels or areas are typically unlocked by completing previous levels or achieving certain milestones within the game.

To unlock new content, focus on completing tasks and challenges in your current levels. This progression system encourages players to explore and master earlier stages.



Can I customize my character or gameplay experience?


Yes, the game allows for character customization, including outfits and abilities, which can enhance your gameplay experience.

Customization options can usually be accessed through the main menu. Players can choose different skins, outfits, or abilities to tailor their character to their play style.

Steps to resolve:
1. Open the main menu.
2. Navigate to the customization section.
3. Select your character.
4. Choose the desired outfit or ability.



What strategies can I use to improve my gameplay?


To improve your gameplay, focus on mastering controls, understanding level layouts, and utilizing power-ups effectively.

Developing strategies involves practicing your skills, learning enemy patterns, and knowing when to use power-ups. This will help you progress more efficiently through challenging levels.

Steps to resolve:
1. Spend time practicing in easier levels.
2. Observe enemy movements and patterns.
3. Experiment with different power-ups.
4. Analyze your performance and adjust strategies accordingly.



How can I improve my gameplay experience in Hitman Blood Money?


To enhance your gameplay, focus on mastering stealth techniques and utilizing disguises effectively. Pay attention to NPC patterns and use the environment to your advantage.

Improving your gameplay involves understanding the mechanics of stealth and strategy. By observing enemy movements and using disguises, you can navigate levels more efficiently and complete objectives without being detected.



What strategies can I use to complete levels without repeating them?


Plan your approach before entering a level. Identify key targets and potential escape routes. Use distractions to manipulate NPCs and create opportunities for stealthy kills.

To avoid repeating levels, develop a strategy that includes scouting the area for useful items and understanding the layout. Use distractions like throwing objects to divert attention, allowing you to execute your plan smoothly.

Steps to resolve:
1. Analyze the level layout and identify key targets.
2. Gather information on NPC behaviors and routines.
3. Use distractions to create openings for stealth kills.
4. Execute your plan and adapt as necessary.



How do I unlock new weapons and items in Hitman Absolution?


Unlocking new weapons and items typically involves completing missions and achieving specific objectives. Pay attention to challenges and side missions for additional rewards.

To unlock new weapons and items, focus on completing main missions and optional challenges. Each completed objective can yield rewards, including new gear. Explore the game thoroughly to find hidden items and complete side quests.

Steps to resolve:
1. Complete main missions to progress the story.
2. Engage in side missions and challenges for extra rewards.
3. Explore each level for hidden items and collectibles.
4. Check your inventory regularly to see unlocked items.

# What're users talking about Vector Classic Mod APK

Download HappyMod to join real time talk with millions of users.

  • User reviews
  • User requests

Write a review for Vector Classic Mod APK

Rate it:

Average rating out of 38

5.0
Submit a review

User reviews (38)

Z

@Anonymous   2025-12-08 17:34:00

From:ZM   Device:Nova_10_Pro_4G   OS:android 14
I love this game victor

I

@Anonymous   2025-11-23 03:26:01

From:IR   Device:21061110AG   OS:android 13
so good.. Even when it's so old now.

P

@Anonymous   2025-11-14 02:14:49

From:PK   Device:TECNO BG6   OS:android 13
معراج سیوڑہ ? ملک معراج سیوڑہ ?

K

@Anonymous   2025-11-02 02:11:24

From:KE   Device:TECNO CD6j   OS:android 10
It's actually works, u get ur money after the first level ?

Z

@Anonymous   2025-11-01 17:03:02

From:ZA   Device:GFY-LX2   OS:android 14
it's awesome and I it if it didn't end

Z

@Anonymous   2025-10-25 11:04:08

From:ZA   Device:ANE-LX1   OS:android 9
Best of the best game that you can find

Z

@Anonymous   2025-10-18 22:14:24

From:ZA   Device:SM-G960F   OS:android 10
brings back old time

Z

@Anonymous   2025-10-07 17:15:17

From:ZA   Device:SM-A032F   OS:android 13
app not compatible with my phone. wish it said that before I download it!?

Z

@Anonymous   2025-10-07 04:44:45

From:ZA   Device:WKG-LX9   OS:android 10
The game doesn't play on my phone ??

P

@Anonymous   2025-09-30 23:41:21

From:PK   Device:OPPO A57   OS:android 6.0.1
not launching after installing the game

P

@Anonymous   2025-09-28 05:41:30

From:PK   Device:Infinix X650C   OS:android 9
so nice I'm impressed

P

@Anonymous   2025-09-26 20:04:30

From:PH   Device:CPH1729   OS:android 7.1.1
beutiful game and so smooth game to play

U

@Anonymous   2025-09-16 17:10:19

From:US   Device:CPH2421   OS:android 11
this is good app thank you for happy mod

E

@Anonymous   2025-09-06 05:51:11

From:EG   Device:24117RN76G   OS:android 15
Very good game it was worth the time

P

@Anonymous   2025-08-24 22:16:12

From:PK   Device:Pixel 7 Pro   OS:android 16
Your hard work paid off Mr.. this game is amazing

G

@Anonymous   2025-08-20 03:30:38

From:GB   Device:M2010J19SG   OS:android 12
it's definitely working and it's gorgeous

U

@Anonymous   2025-08-16 17:36:03

From:US   Device:TECNO BG6   OS:android 13
this is interesting game

U

@Anonymous   2025-08-10 22:37:28

From:US   Device:RMX2085   OS:android 12
good game with aura level

U

@Anonymous   2025-08-02 22:26:11

From:US   Device:24040RN64Y   OS:android 14
it's working perfectly

I

@Anonymous   2025-08-02 13:49:39

From:IN   Device:24074RPD2I   OS:android 15
works great and perfectly unlocked no ads

More...[+]

Request a latest version of Vector Classic Mod

If this mod doesn't work, you can send a request to HappyMod community. Users will upload a new mod if they've one.
Send a request

Latest requests related to Vector Classic

B

@Anonymous   2023-02-14 06:55:50

From:BR   Device:LGE LM-K420   OS:android 12
quero ter tudo desbloqueado porque bem simples kkkkkkkkkkkkkkkkkkkkkkkkk

Z

@Anonymous   2022-12-28 21:30:44

From:ZA   Device:samsung SM-A115F   OS:android 12
GUYS PLEASE I'm beggin unlimited coins PLEASE and 100% working pls

B

@Anonymous   2022-11-17 21:11:16

From:BR   Device:LGE LM-K200   OS:android 10
this thing is very buggy it appears that it was not installed this is ****

G

@Anonymous   2022-11-13 17:14:03

From:GB   Device:samsung SM-T736B   OS:android 12
pls a working mod i really need it because my friends are making fun of me

U

@Anonymous   2022-11-09 11:19:46

From:US   Device:OPPO CPH1909   OS:android 8.1.0
all free all fre coins free all skin free hero free all unlimited free all

4

@Anonymous   2022-10-30 21:21:49

From:419   Device:Amazon KFAUWI   OS:android 5.1.1
Sjyjwldkwkdjskksidndiakekdiakfizkdmdkdkdmdiskkwkdkskqksikdkekdkdmfkek

P

@Anonymous   2022-10-13 14:53:01

From:PL   Device:Xiaomi M2004J19C   OS:android 11
✨dobrze jest chłopaki dobrze robia pozdro✨ Polish mem

U

@Anonymous   2022-08-11 09:08:51

From:US   Device:samsung SM-A107M   OS:android 11
vector 2 plsssssssssssssssssssssssssssssssssssssssssssssss

G

@Anonymous   2022-07-02 19:24:57

From:GB   Device:samsung SM-A217F   OS:android 11
dihdhdhdhdhfjcgkdrjlsezkaezkadhmahdydhfuyzyzeyzryruxfuydyfuyurxurxtuxruyuryzdoyzsi

U

@Anonymous   2022-04-18 21:14:02

From:US   Device:Lenovo Lenovo L38011   OS:android 8.0.0
It's a Joss game. That's why we need this game. Please mod this Game. Thank you.

G

@Anonymous   2022-04-17 14:14:52

From:GB   Device:samsung SM-J700F   OS:android 6.0.1
sir .swordigo unlimited coin in all divice

E

@Anonymous   2022-03-27 05:30:58

From:ES   Device:samsung SM-A125F   OS:android 11
Tienes dinero infinito y también 54 millones de estrellas y si compras algo pues te aumenta más dinero xddddddd

T

@Anonymous   2022-03-22 23:40:16

From:TR   Device:realme RMX3231   OS:android 11
Vector Full'un yeni sürümü olan 1.3.2. sürümü çıktı.Fakat para hileli ve Full sürümü HappyMod'da yok lütfen 1.3.2. sürümünü full ve para hileli bir şekilde sunabilir misiniz?

E

@Anonymous   2022-03-20 12:51:58

From:EG   Device:TECNO MOBILE LIMITED TECNO LE7   OS:android 11
123456789123456789123456789 242612121212124272126131212

N

@Anonymous   2022-03-20 11:07:16

From:NZ   Device:samsung SM-A105G   OS:android 10
i just lit my new born baby and my 16 year old wife on fire, my entire house burnt down as well, lol.

I

@Anonymous   2022-03-17 13:53:03

From:IN   Device:Xiaomi Redmi K20 Pro   OS:android 11
can you please add vector to happy mod. Need to play this game

I

@Anonymous   2022-03-16 20:03:53

From:ID   Device:realme RMX2103   OS:android 10
gzbzbhzhzishshshshshhdhdbdvdbshnsbsvshshsvsbsbjsbsbsbjsjsjsjsjjsjsjshs

U

@Anonymous   2022-03-16 19:11:02

From:US   Device:vivo vivo 1906   OS:android 11
akbaishsjsjsjsjjsjshsjshshahavakanbakanalllqmwnwmsksjneisnsbskw. wnwkwnwkwnwjsbsklsksjskajahaiahjaiabajajahsjshahahabshahabajshkjsshsisvsbsjshs

M

@Anonymous   2022-03-16 18:52:03

From:MA   Device:TECNO MOBILE LIMITED TECNO KE5j   OS:android 10
gdgsgsgdgshafshdfdjdcdbdcdbdhdvdbdhdgsjagahsfdjst hsgsjfsjdjsdshscsjsvsh

M

@Anonymous   2022-03-16 18:29:43

From:MY   Device:samsung SM-A025F   OS:android 10
nk main game ni sebab lama tak main dan mahu cuba yang baru

More...[+]

Logo

HappyMod

Best mod downloader
for 100% working mods.

Vector Classic Mod apk ~ download faster with HappyMod.

Other Versions

Found (8) versions of Vector Classic Mod

Vector Classic Mod Apk
Vector Classic Mod Apk [Remove ads][Unlimited money][Free purchase][Full]

Vector Classic Mod Apk [Remove ads][Unlimited money][Free purchase][Full]

Free full version, sufficient currency (need to pass the first level)
[Reminder] This game needs to be installed with Google Figures. There is no netizens who have Google three-piece sets of Google. Please install it on the client of the percentage.
No Ads
Vector Classic Mod Apk [Unlimited money]

Vector Classic Mod Apk [Unlimited money]

Enter the game to receive a large amount of currency

Vector Classic Mod Apk [Unlimited money][Free purchase]

A large amount of currency, Google Market $ 0.99, good game, payment games for free!

Vector Classic Mod Apk [Unlimited money]

Acquired a large number of game currency.

More...[+]

Related Mods

People who download Vector Classic Mod also like...

Tower Knights Mod Apk

Tower Knights Mod Apk

Game modify gem for 99998888, complete the tutorial you can get!
Vive le Roi 2 Mod Apk [Free purchase][Unlocked]

Vive le Roi 2 Mod Apk [Free purchase][Unlocked]

Google Market 6.99 US dollars payment games to play free!
The game has been unlocked the relevant card
Supermarket Tycoon Mod Apk [Remove ads][Unlimited money]

Supermarket Tycoon Mod Apk [Remove ads][Unlimited money]

Enter the game to get a lot of currency
No Ads

More...[+]

Other Apps from this developer

Explore more great apps from the same developer...

Shadow Fight 2 Mod Apk 2.41.9 [Unlimited money]

Shadow Fight 2 Mod Apk 2.41.9 [Unlimited money]

MOD: Unlimited Money
No Ads
Mod Menu
Vector 2 Mod Apk 1.2.0 [Unlimited money]

Vector 2 Mod Apk 1.2.0 [Unlimited money]

MOD, Unlimited Money
No Ads
Mod Menu
Shadow Fight 4: Arena Mod Apk 1.9.55

Shadow Fight 4: Arena Mod Apk 1.9.55

Please check our installation guide.
Thanks For Using ModsManiac!

Beat da Beat Free Mod Apk 1.10 [Unlimited money]

The game has been modified every time you enter the game with two coins will become 25252525, if they go into a black screen, please disconnect the network, and press the Return key.

More...[+]